UniProt ID | ARAD1_ARATH | |
---|---|---|
UniProt AC | Q6DBG8 | |
Protein Name | Probable arabinosyltransferase ARAD1 | |
Gene Name | ARAD1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 447 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
Protein Description | Probable arabinosyl transferase responsible for the polymerization of arabinose into the arabinan of arabinogalactan. May function as inverting enzyme using UDP-beta-L-arabinopyranoside. May be important for arabinan side chains of rhamnogalacturonan I (RG-I), a major component of pectins. Cell wall pectic arabinans are involved in thigmomorphogenesis response of inflorescence stems to mechanical stress.. | |
Protein Sequence | MARKSSLLKRAAIAVVSVIAIYVILNASVSRSLPSSSDLPRQLIREDDDDEGRAPIQPRVRVYMYNLPKRFTYGLIEQHSIARGGIKKPVGDVTTLKYPGHQHMHEWYLFSDLNQPEVDRSGSPIVRVSDPADADLFYVPVFSSLSLIVNAGRPVEAGSGYSDEKMQEGLVEWLEGQEWWRRNAGRDHVIPAGDPNALYRILDRVKNAVLLVSDFGRLRPDQGSFVKDVVIPYSHRVNLFNGEIGVEDRNTLLFFMGNRYRKDGGKVRDLLFQVLEKEDDVTIKHGTQSRENRRAATKGMHTSKFCLNPAGDTPSACRLFDSIVSLCVPLIVSDSIELPFEDVIDYRKFSIFVEANAALQPGFLVQMLRKIKTKKILEYQREMKSVRRYFDYDNPNGAVKEIWRQVSHKLPLIKLMSNRDRRLVLRNLTEPNCSCLCTNQTGLITSI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
65 | Phosphorylation | PRVRVYMYNLPKRFT CEEEEEEEECCCCCC | 19880383 | ||
379 | Phosphorylation | KTKKILEYQREMKSV CHHHHHHHHHHHHHH | 19880383 | ||
427 | N-linked_Glycosylation | DRRLVLRNLTEPNCS CHHHHHCCCCCCCCE | - | ||
432 | N-linked_Glycosylation | LRNLTEPNCSCLCTN HCCCCCCCCEEEEEC | - | ||
439 | N-linked_Glycosylation | NCSCLCTNQTGLITS CCEEEEECCCCCEEE | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARAD1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARAD1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARAD1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARAD1_ARATH | ARAD1 | physical | 25326916 | |
ARAD2_ARATH | ARAD2 | physical | 22270560 | |
ARAD1_ARATH | ARAD1 | physical | 22270560 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...