UniProt ID | APOC1_HUMAN | |
---|---|---|
UniProt AC | P02654 | |
Protein Name | Apolipoprotein C-I | |
Gene Name | APOC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 83 | |
Subcellular Localization | Secreted . | |
Protein Description | Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.. | |
Protein Sequence | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | PVLVVVLSIVLEGPA HHHHHHHHHHHCCCC | 10.07 | 22210691 | |
27 | Phosphorylation | GPAPAQGTPDVSSAL CCCCCCCCCCHHHHH | 12.30 | 22210691 | |
31 | Phosphorylation | AQGTPDVSSALDKLK CCCCCCHHHHHHHHH | 19.78 | 22210691 | |
32 | Phosphorylation | QGTPDVSSALDKLKE CCCCCHHHHHHHHHH | 32.47 | 22210691 | |
53 | Phosphorylation | DKARELISRIKQSEL HHHHHHHHHHHHHHH | 40.35 | 24719451 | |
53 | O-linked_Glycosylation | DKARELISRIKQSEL HHHHHHHHHHHHHHH | 40.35 | OGP | |
63 | Ubiquitination | KQSELSAKMREWFSE HHHHHHHHHHHHHHH | 34.80 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APOC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APOC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APOC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NSG2_HUMAN | HMP19 | physical | 21900206 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...