APH1B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APH1B_HUMAN
• UniProt AC: Q8WW43
• Protein Name: Gamma-secretase subunit APH-1B
• Gene Name: APH1B
• Organism: Homo sapiens (Human).
• Sequence Length: 257
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (amyloid-beta precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. Probably present in a minority of gamma-secretase complexes compared to APH1A..
• Protein Sequence: MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTAAVFFGC ------CCHHHHHCH	24.27	24043423
21	Phosphorylation	FGPALALYVFTIATE HHHHHHHHHHHHCCC	6.47	24043423
24	Phosphorylation	ALALYVFTIATEPLR HHHHHHHHHCCCHHH	10.31	24043423
27	Phosphorylation	LYVFTIATEPLRIIF HHHHHHCCCHHHHHH	33.99	24719451
92	Ubiquitination	MFRFAYYKLLKKASE HHHHHHHHHHHHHHH	34.37	21890473
92	Ubiquitination	MFRFAYYKLLKKASE HHHHHHHHHHHHHHH	34.37	21890473
95	Ubiquitination	FAYYKLLKKASEGLK HHHHHHHHHHHHHHC	57.65	22817900
96	Ubiquitination	AYYKLLKKASEGLKS HHHHHHHHHHHHHCC	58.05	22817900
102	Ubiquitination	KKASEGLKSINPGET HHHHHHHCCCCCCCC	61.21	21906983
247	Ubiquitination	LCLLCQDKNFLLYNQ HHHHHCCCCEEHEEC	24.58	-
252	Phosphorylation	QDKNFLLYNQRSR-- CCCCEEHEECCCC--	16.05	27642862
256	Phosphorylation	FLLYNQRSR------ EEHEECCCC------	32.36	24247654

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APH1B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APH1B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APH1B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NICA_HUMAN	NCSTN	physical	15474363
PEN2_HUMAN	PSENEN	physical	15474363
PSN1_HUMAN	PSEN1	physical	15474363
PSN2_HUMAN	PSEN2	physical	15474363

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.