| UniProt ID | APC11_ARATH | |
|---|---|---|
| UniProt AC | Q9M9L0 | |
| Protein Name | Anaphase-promoting complex subunit 11 {ECO:0000303|PubMed:14508008} | |
| Gene Name | APC11 {ECO:0000303|PubMed:14508008} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 84 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication. May recruit the E2 ubiquitin-conjugating enzymes to the complex (By similarity).. | |
| Protein Sequence | MKVKILQWHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAHCPMCRREWQFKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of APC11_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APC11_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APC11_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APC11_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| APC2_ARATH | APC2 | physical | 14508008 | |
| APC1_ARATH | EMB2771 | physical | 20706207 | |
| APC2_ARATH | APC2 | physical | 20706207 | |
| CDC23_ARATH | APC8 | physical | 20706207 | |
| RH28_ARATH | AT4G16630 | physical | 20706207 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...