dbPTM

APC11_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	APC11_ARATH
UniProt AC	Q9M9L0
Protein Name	Anaphase-promoting complex subunit 11 {ECO:0000303\|PubMed:14508008}
Gene Name	APC11 {ECO:0000303\|PubMed:14508008}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	84
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication. May recruit the E2 ubiquitin-conjugating enzymes to the complex (By similarity)..
Protein Sequence	MKVKILQWHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAHCPMCRREWQFKE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of APC11_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of APC11_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of APC11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of APC11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APC2_ARATH	APC2	physical	14508008
APC1_ARATH	EMB2771	physical	20706207
APC2_ARATH	APC2	physical	20706207
CDC23_ARATH	APC8	physical	20706207
RH28_ARATH	AT4G16630	physical	20706207

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of APC11_ARATH

Related Literatures of Post-Translational Modification