UniProt ID | AP2A_MOUSE | |
---|---|---|
UniProt AC | P34056 | |
Protein Name | Transcription factor AP-2-alpha | |
Gene Name | Tfap2a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 437 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.. | |
Protein Sequence | MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALGSGLGDLPIHSLPHAIEDVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNSAKSSDKEEKHRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
119 | Phosphorylation | RGLPHQLSGLDPRRD CCCCHHHCCCCCCCC | 30.64 | 101546439 | |
185 | Phosphorylation | GPVSLSKSNSNAVSA CCCCCCCCCCCCCEE | 41.96 | 23375375 | |
187 | Phosphorylation | VSLSKSNSNAVSAIP CCCCCCCCCCCEEEE | 33.00 | 6371355 | |
219 | Phosphorylation | CSVPGRLSLLSSTSK EECCCCCHHCCCCCC | 26.38 | 51163007 | |
223 | Phosphorylation | GRLSLLSSTSKYKVT CCCHHCCCCCCEEEE | 36.35 | 22006019 | |
225 | Phosphorylation | LSLLSSTSKYKVTVA CHHCCCCCCEEEEHH | 35.62 | 29514104 | |
230 | Phosphorylation | STSKYKVTVAEVQRR CCCCEEEEHHHHHHH | 15.17 | - | |
239 | Phosphorylation | AEVQRRLSPPECLNA HHHHHHCCCHHHHCH | 36.28 | 22817900 | |
258 | Phosphorylation | GVLRRAKSKNGGRSL HHHHHHHHCCCCHHH | 30.30 | 10049257 | |
263 | Methylation | AKSKNGGRSLREKLD HHHCCCCHHHHHHHH | 33.64 | - | |
287 | Phosphorylation | RRKAANVTLLTSLVE CHHHCCEEEEEHHHH | 18.83 | 27180971 | |
290 | Phosphorylation | AANVTLLTSLVEGEA HCCEEEEEHHHHCCH | 24.11 | 27180971 | |
291 | Phosphorylation | ANVTLLTSLVEGEAV CCEEEEEHHHHCCHH | 30.32 | 27180971 | |
420 | Phosphorylation | YLSNNPNSHTDNSAK HHHCCCCCCCCCCCC | 29.08 | 29514104 | |
425 | Phosphorylation | PNSHTDNSAKSSDKE CCCCCCCCCCCCCHH | 39.62 | 28576409 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
10 | K | Sumoylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP2A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AP2D_MOUSE | Tfap2d | physical | 20211142 | |
CITE2_MOUSE | Cited2 | physical | 11694877 | |
BRE1A_MOUSE | Rnf20 | physical | 24374663 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...