dbPTM

ANM11_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ANM11_ARATH
UniProt AC	Q9SU94
Protein Name	Protein arginine N-methyltransferase 1.1
Gene Name	PRMT11
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	390
Subcellular Localization	Nucleus. Cytoplasm. Excluded from nucleolus.
Protein Description	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in a glycine and arginine-rich domain. Type I arginine methyltransferase active on both histones and non-histone proteins. Required for leaves and flowers development. Mediates the methylation of MBD7 and MED36A..
Protein Sequence	MTKNSNHDENEFISFEPNQNTKIRFEDADEDEVAEGSGVAGEETPQDESMFDAGESADTAEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFENMLDSVLYARDKWLVEGGVVLPDKASLHLTAIEDSEYKEDKIEFWNSVYGFDMSCIKKKAMMEPLVDTVDQNQIVTDSRLLKTMDISKMSSGDASFTAPFKLVAQRNDYIHALVAYFDVSFTMCHKLLGFSTGPKSRATHWKQTVLYLEDVLTICEGETITGTMSVSPNKKNPRDIDIKLSYSLNGQHCKISRTQHYKMR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTKNSNHDE ------CCCCCCCCC	38.64	24601666
5	Phosphorylation	---MTKNSNHDENEF ---CCCCCCCCCCCC	36.78	24601666
14	Phosphorylation	HDENEFISFEPNQNT CCCCCCEECCCCCCC	28.95	27643528

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ANM11_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ANM11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ANM11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MD36A_ARATH	FIB2	physical	17666011
MBD7_ARATH	MBD7	physical	17711414
H2A3_ARATH	HTA2	physical	17711414
H2B10_ARATH	HTB2	physical	17711414
H33_ARATH	AT4G40030	physical	17711414

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ANM11_ARATH

Related Literatures of Post-Translational Modification