UniProt ID | AN32A_MOUSE | |
---|---|---|
UniProt AC | O35381 | |
Protein Name | Acidic leucine-rich nuclear phosphoprotein 32 family member A | |
Gene Name | Anp32a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 247 | |
Subcellular Localization | Nucleus . Cytoplasm . Endoplasmic reticulum. Shuttles between nucleus and cytoplasm. Translocates to the cytoplasm during the process of neuritogenesis. | |
Protein Description | Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression.. | |
Protein Sequence | MEMDKRIYLELRNRTPSDVKELVLDNCKSIEGKIEGLTDEFEELEFLSTINVGLTSISNLPKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEEDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MEMDKRIYLELRNRT CCCCHHHHHHHCCCC | 9.73 | 23023260 | |
15 | Phosphorylation | YLELRNRTPSDVKEL HHHHCCCCHHHHHHH | 30.60 | 25521595 | |
17 | Phosphorylation | ELRNRTPSDVKELVL HHCCCCHHHHHHHHH | 55.19 | 25521595 | |
20 | Ubiquitination | NRTPSDVKELVLDNC CCCHHHHHHHHHHHH | 50.77 | 22790023 | |
27 | Glutathionylation | KELVLDNCKSIEGKI HHHHHHHHHHCCCHH | 3.50 | 24333276 | |
28 | Ubiquitination | ELVLDNCKSIEGKIE HHHHHHHHHCCCHHC | 61.80 | - | |
28 | Malonylation | ELVLDNCKSIEGKIE HHHHHHHHHCCCHHC | 61.80 | 26320211 | |
68 | Ubiquitination | PKLNKLKKLELSENR CCHHCCCCCCCCCCC | 58.59 | 22790023 | |
72 | Phosphorylation | KLKKLELSENRISGD CCCCCCCCCCCCCCC | 24.37 | 22817900 | |
77 | Phosphorylation | ELSENRISGDLEVLA CCCCCCCCCCHHHHH | 24.02 | 26824392 | |
86 | Ubiquitination | DLEVLAEKCPNLKHL CHHHHHHHCCCCCEE | 49.76 | 22790023 | |
91 | Ubiquitination | AEKCPNLKHLNLSGN HHHCCCCCEECCCCC | 53.32 | 22790023 | |
99 | Ubiquitination | HLNLSGNKIKDLSTI EECCCCCCCCCHHHC | 55.44 | - | |
99 | Malonylation | HLNLSGNKIKDLSTI EECCCCCCCCCHHHC | 55.44 | 26320211 | |
101 | Ubiquitination | NLSGNKIKDLSTIEP CCCCCCCCCHHHCHH | 54.98 | - | |
101 | Malonylation | NLSGNKIKDLSTIEP CCCCCCCCCHHHCHH | 54.98 | 26320211 | |
104 | Phosphorylation | GNKIKDLSTIEPLKK CCCCCCHHHCHHHHH | 37.16 | 54887289 | |
105 | Phosphorylation | NKIKDLSTIEPLKKL CCCCCHHHCHHHHHH | 36.34 | 23984901 | |
117 | Phosphorylation | KKLENLKSLDLFNCE HHHHCCCCCCCCCCE | 30.22 | 26643407 | |
137 | Ubiquitination | AYRENVFKLLPQVMY HHHHHHHHHHCCCCC | 44.85 | 22790023 | |
158 | Phosphorylation | DNKEAPDSDVEGYVE CCCCCCCCCCCCCCC | 42.36 | 61321 | |
202 | Phosphorylation | EGEEEDVSGEEEEDE HCCCCCCCCCHHHCC | 53.46 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AN32A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AN32A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AN32A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
E4F1_MOUSE | E4f1 | physical | 17557114 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...