dbPTM

ALEU_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ALEU_ARATH
UniProt AC	Q8H166
Protein Name	Thiol protease aleurain
Gene Name	ALEU
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	358
Subcellular Localization	Vacuole . Predominantly vacuolar. From the Golgi apparatus, transported to the lytic vacuole (LV) in clathrin-coated vesicles (CCVs) via the prevacuolar compartment (PVC). In root elongating cells and stomata, localized in central vacuole and in smal
Protein Description	May play a role in proteolysis leading to mobilization of nitrogen during senescence and starvation..
Protein Sequence	MSAKTILSSVVLVVLVAASAAANIGFDESNPIRMVSDGLREVEESVSQILGQSRHVLSFARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKLGAAQNCSATLKGSHKVTEAALPETKDWREDGIVSPVKDQGGCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGAFNNYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKDETCKFSAENVGVQVLNSVNITLGAEDELKHAVGLVRPVSIAFEVIHSFRLYKSGVYTDSHCGSTPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCGIATCASYPVVA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
125	N-linked_Glycosylation	TKLGAAQNCSATLKG HHCHHHCCCCCCCCC	19.58	-
127	Phosphorylation	LGAAQNCSATLKGSH CHHHCCCCCCCCCCC	31.66	24243849
254	N-linked_Glycosylation	VQVLNSVNITLGAED CEEEEECCEEECCCH	22.73	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ALEU_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ALEU_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ALEU_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
VSR3_ARATH	VSR3	physical	14749481

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ALEU_ARATH

Related Literatures of Post-Translational Modification