dbPTM

VSR3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VSR3_ARATH
UniProt AC	O80977
Protein Name	Vacuolar-sorting receptor 3
Gene Name	VSR3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	628
Subcellular Localization	Membrane Single-pass type I membrane protein. Golgi apparatus membrane Single-pass type I membrane protein. Cytoplasmic vesicle, clathrin-coated vesicle membrane Single-pass type I membrane protein. Prevacuolar compartment membrane Single-pass type I
Protein Description	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles..
Protein Sequence	MKQLLCYLPWLLLLTLLVSPLNDARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMEFVKDFKGAAQILEKGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCAPDPEQDFSSGYDGKDVVVENLRQLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKECADSVIKSLGIDSKKLDKCMGDPDADLDNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKSAVLKALCSGFEETTEPAICLSTDVESNECLDNNGGCWQDKSANITACKDTFRGRVCECPTVDGVQFKGDGYSHCEPSGPGRCTINNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIPNHVNDERA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
148	N-linked_Glycosylation	SSAKYIENITIPSAL CCCHHEECCCCCHHH	27.43	-
294	N-linked_Glycosylation	LCVYKVANETGKPWV HHHHHHHCCCCCCEE	50.80	-
331	Phosphorylation	CADSVIKSLGIDSKK HHHHHHHHCCCCHHH	22.24	24924143
434	N-linked_Glycosylation	CWQDKSANITACKDT CCCCCCCCCCCCCHH	38.95	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VSR3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VSR3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VSR3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of VSR3_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VSR3_ARATH

Related Literatures of Post-Translational Modification