UniProt ID | AKIRN_DROME | |
---|---|---|
UniProt AC | Q9VS59 | |
Protein Name | Akirin | |
Gene Name | akirin {ECO:0000303|PubMed:18066067} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 201 | |
Subcellular Localization | Nucleus . | |
Protein Description | Required for embryonic development and for normal innate immune response. Effector of immune deficiency pathway (Imd) acting either downstream of, or at the level of, the NF-kappa-B factor Relish (Rel). Not part of the Toll pathway.. | |
Protein Sequence | MACATLKRALDWESMNQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKDSTEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSEMGPESPRRPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQIQRRYEAAPSYLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Phosphorylation | GSNAGPASPSRDGPS CCCCCCCCCCCCCCC | 26.92 | 22817900 | |
41 | Phosphorylation | NAGPASPSRDGPSTS CCCCCCCCCCCCCCC | 40.27 | 22817900 | |
67 | Phosphorylation | AKDSTEPSPFSESSL CCCCCCCCCCCHHHH | 32.14 | 18327897 | |
78 | Phosphorylation | ESSLAKMSPDKMAES HHHHHHCCHHHHHHH | 29.28 | 22817900 | |
115 | Phosphorylation | RMQDSESSGSEMGPE HHHHCCCCCCCCCCC | 42.14 | 22817900 | |
123 | Phosphorylation | GSEMGPESPRRPDSP CCCCCCCCCCCCCCH | 27.17 | 22817900 | |
129 | Phosphorylation | ESPRRPDSPQNLMRH CCCCCCCCHHHHHHH | 30.94 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKIRN_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKIRN_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKIRN_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAP60_DROME | Bap60 | physical | 25180232 | |
NFKB1_DROME | Rel | physical | 25180232 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-39; SER-41; SER-67;SER-123 AND SER-129, AND MASS SPECTROMETRY. |