UniProt ID | AF1Q_HUMAN | |
---|---|---|
UniProt AC | Q13015 | |
Protein Name | Protein AF1q | |
Gene Name | MLLT11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 90 | |
Subcellular Localization | Nucleus . Cytoplasm . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Continuous nuclear export is followed by degradation. | |
Protein Description | Cofactor for the transcription factor TCF7. [PubMed: 26079538 Involved in regulation of lymphoid development by driving multipotent hematopoietic progenitor cells towards a T cell fate] | |
Protein Sequence | MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MRDPVSSQYSSFLF -CCCCCCHHCHHEEE | 33.11 | - | |
9 | Phosphorylation | RDPVSSQYSSFLFWR CCCCCHHCHHEEEEC | 14.29 | - | |
16 | Methylation | YSSFLFWRMPIPELD CHHEEEECCCCCCCC | 17.42 | 115386293 | |
38 | Phosphorylation | GLSDTATYKVKDSSV CCCCCEEEEEECCHH | 16.01 | - | |
39 | Ubiquitination | LSDTATYKVKDSSVG CCCCEEEEEECCHHH | 38.15 | 21906983 | |
41 | Acetylation | DTATYKVKDSSVGKM CCEEEEEECCHHHHH | 47.98 | 25953088 | |
41 | Ubiquitination | DTATYKVKDSSVGKM CCEEEEEECCHHHHH | 47.98 | - | |
43 | Phosphorylation | ATYKVKDSSVGKMIG EEEEEECCHHHHHEE | 22.62 | 30631047 | |
44 | Phosphorylation | TYKVKDSSVGKMIGQ EEEEECCHHHHHEEE | 45.05 | 30624053 | |
47 | Ubiquitination | VKDSSVGKMIGQATA EECCHHHHHEEEEEC | 25.78 | 21890473 | |
47 | Acetylation | VKDSSVGKMIGQATA EECCHHHHHEEEEEC | 25.78 | 25953088 | |
48 | Sulfoxidation | KDSSVGKMIGQATAA ECCHHHHHEEEEECC | 3.24 | 21406390 | |
53 | Phosphorylation | GKMIGQATAADQEKN HHHEEEEECCCCCCC | 17.94 | 30624053 | |
59 | Ubiquitination | ATAADQEKNPEGDGL EECCCCCCCCCCCCC | 72.65 | - | |
69 | Phosphorylation | EGDGLLEYSTFNFWR CCCCCEEEECEEEEC | 17.00 | - | |
81 | Phosphorylation | FWRAPIASIHSFELD EECCCCCEEEEEEEE | 22.89 | 22617229 | |
84 | Phosphorylation | APIASIHSFELDLL- CCCCEEEEEEEECC- | 20.81 | 22617229 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AF1Q_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AF1Q_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AF1Q_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S100B_HUMAN | S100B | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...