| UniProt ID | ADPRH_HUMAN | |
|---|---|---|
| UniProt AC | P54922 | |
| Protein Name | [Protein ADP-ribosylarginine] hydrolase | |
| Gene Name | ADPRH | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 357 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the reverse reaction of mono-ADP-ribosylation.. | |
| Protein Sequence | MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MEKYVAAMVLS ----CHHHHHHHHHH | 5.09 | 19835603 | |
| 19 | Phosphorylation | AAGDALGYYNGKWEF HHHHHHHHHCCEEEE | 8.46 | 19835603 | |
| 20 | Phosphorylation | AGDALGYYNGKWEFL HHHHHHHHCCEEEEH | 18.68 | 22817900 | |
| 205 | Phosphorylation | LLPEAKKYIVQSGYF HCHHHHHHHHHCCCC | 12.96 | 68735555 | |
| 209 | Phosphorylation | AKKYIVQSGYFVEEN HHHHHHHCCCCHHHC | 25.27 | 68735561 | |
| 241 | Phosphorylation | RGILDGESAPTFPES CCCCCCCCCCCCCHH | 45.11 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADPRH_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADPRH_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADPRH_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TFCP2_HUMAN | TFCP2 | physical | 25416956 | |
| XRN1_HUMAN | XRN1 | physical | 28514442 | |
| OBSL1_HUMAN | OBSL1 | physical | 28514442 | |
| BCAT1_HUMAN | BCAT1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
