UniProt ID | ADPRH_HUMAN | |
---|---|---|
UniProt AC | P54922 | |
Protein Name | [Protein ADP-ribosylarginine] hydrolase | |
Gene Name | ADPRH | |
Organism | Homo sapiens (Human). | |
Sequence Length | 357 | |
Subcellular Localization | ||
Protein Description | Catalyzes the reverse reaction of mono-ADP-ribosylation.. | |
Protein Sequence | MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MEKYVAAMVLS ----CHHHHHHHHHH | 5.09 | 19835603 | |
19 | Phosphorylation | AAGDALGYYNGKWEF HHHHHHHHHCCEEEE | 8.46 | 19835603 | |
20 | Phosphorylation | AGDALGYYNGKWEFL HHHHHHHHCCEEEEH | 18.68 | 22817900 | |
205 | Phosphorylation | LLPEAKKYIVQSGYF HCHHHHHHHHHCCCC | 12.96 | 68735555 | |
209 | Phosphorylation | AKKYIVQSGYFVEEN HHHHHHHCCCCHHHC | 25.27 | 68735561 | |
241 | Phosphorylation | RGILDGESAPTFPES CCCCCCCCCCCCCHH | 45.11 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADPRH_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADPRH_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADPRH_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TFCP2_HUMAN | TFCP2 | physical | 25416956 | |
XRN1_HUMAN | XRN1 | physical | 28514442 | |
OBSL1_HUMAN | OBSL1 | physical | 28514442 | |
BCAT1_HUMAN | BCAT1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...