UniProt ID | ACT5_DROME | |
---|---|---|
UniProt AC | P10981 | |
Protein Name | Actin-87E | |
Gene Name | Act87E | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 376 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.; Multiple isoforms are involved in various cellular functions such as cytoskeleton structure, cell mobility, chromosome movement and muscle contraction.. | |
Protein Sequence | MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Acetylation | -----MCDDEVAALV -----CCCCCCEEEE | 54.53 | - | |
34 | Phosphorylation | APRAVFPSIVGRPRH CCCCCCHHHCCCCCC | 20.59 | 22817900 | |
45 | Methionine sulfoxide | RPRHQGVMVGMGQKD CCCCCCEEEECCCCC | 2.49 | - | |
45 | Oxidation | RPRHQGVMVGMGQKD CCCCCCEEEECCCCC | 2.49 | 22116028 | |
48 | Methionine sulfoxide | HQGVMVGMGQKDSYV CCCEEEECCCCCCCC | 3.32 | - | |
48 | Oxidation | HQGVMVGMGQKDSYV CCCEEEECCCCCCCC | 3.32 | 22116028 | |
51 | Acetylation | VMVGMGQKDSYVGDE EEEECCCCCCCCCCH | 42.80 | 19608861 | |
53 | Phosphorylation | VGMGQKDSYVGDEAQ EECCCCCCCCCCHHH | 28.84 | 21082442 | |
61 | Phosphorylation | YVGDEAQSKRGILTL CCCCHHHCCCCEEEE | 31.22 | 27794539 | |
67 | Phosphorylation | QSKRGILTLKYPIEH HCCCCEEEEECEECC | 21.20 | 22668510 | |
69 | Acetylation | KRGILTLKYPIEHGI CCCEEEEECEECCCC | 43.69 | 19608861 | |
74 | Methylation | TLKYPIEHGIITNWD EEECEECCCCCCCHH | 33.21 | 30526847 | |
107 | Phosphorylation | EEHPVLLTEAPLNPK CCCCEEEEECCCCCC | 26.41 | 22817900 | |
192 | Acetylation | DLTDYLMKILTERGY CHHHHHHHHHHHCCC | 31.78 | 19608861 | |
241 | Phosphorylation | STSLEKSYELPDGQV HCCCHHHEECCCCCE | 32.33 | 29892262 | |
324 | Phosphorylation | EITALAPSTIKIKII HHHHHCCCEEEEEEE | 36.84 | 27794539 | |
325 | Phosphorylation | ITALAPSTIKIKIIA HHHHCCCEEEEEEEC | 25.82 | 27794539 | |
329 | Acetylation | APSTIKIKIIAPPER CCCEEEEEEECCCCC | 24.06 | 19608861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACT5_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACT5_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACT5_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...