UniProt ID | ACPM_DROME | |
---|---|---|
UniProt AC | Q94519 | |
Protein Name | Acyl carrier protein, mitochondrial | |
Gene Name | ND-ACP {ECO:0000312|FlyBase:FBgn0011361} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 152 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | Carrier of the growing fatty acid chain in fatty acid biosynthesis. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).. | |
Protein Sequence | MSFTQIARSCSRLAATLAPRRVASGILIQSQASRMMHRIAVPSMTSQLSQECRGRWQTQLVRKYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
33 | Phosphorylation | ILIQSQASRMMHRIA CCHHHHHHHHHHHHH | 17.05 | 22668510 | |
43 | Phosphorylation | MHRIAVPSMTSQLSQ HHHHHHCHHHHHHCH | 28.26 | 22668510 | |
45 | Phosphorylation | RIAVPSMTSQLSQEC HHHHCHHHHHHCHHH | 20.05 | 22668510 | |
67 (in isoform 2) | Acetylation | - | 41.02 | - | |
72 (in isoform 2) | Acetylation | - | 7.43 | - | |
79 (in isoform 2) | Acetylation | - | 3.85 | - | |
88 | Acetylation | LVLKLYDKIDPSKLN HHHHHHHCCCHHHCC | 35.14 | 21791702 | |
108 | O-(pantetheine 4'-phosphoryl)serine | INDLGLDSLDHVEVI CCCCCCCCCCCEEEH | 40.51 | - | |
108 | Phosphorylation | INDLGLDSLDHVEVI CCCCCCCCCCCEEEH | 40.51 | - | |
136 | Acetylation | SDAEKLLKPADIIKY CHHHHHCCHHHHHHH | 48.90 | 21791702 | |
142 | Acetylation | LKPADIIKYVADKED CCHHHHHHHHCCHHH | 33.72 | 21791702 | |
147 | Acetylation | IIKYVADKEDVYE-- HHHHHCCHHHHCC-- | 46.18 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACPM_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACPM_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACPM_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BCN92_DROME | bcn92 | physical | 22036573 | |
LIPT2_DROME | CG9804 | physical | 22036573 | |
MMD4_DROME | mod(mdg4) | physical | 27025476 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...