| UniProt ID | ACPM_DROME | |
|---|---|---|
| UniProt AC | Q94519 | |
| Protein Name | Acyl carrier protein, mitochondrial | |
| Gene Name | ND-ACP {ECO:0000312|FlyBase:FBgn0011361} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 152 | |
| Subcellular Localization | Mitochondrion. | |
| Protein Description | Carrier of the growing fatty acid chain in fatty acid biosynthesis. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).. | |
| Protein Sequence | MSFTQIARSCSRLAATLAPRRVASGILIQSQASRMMHRIAVPSMTSQLSQECRGRWQTQLVRKYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 33 | Phosphorylation | ILIQSQASRMMHRIA CCHHHHHHHHHHHHH | 17.05 | 22668510 | |
| 43 | Phosphorylation | MHRIAVPSMTSQLSQ HHHHHHCHHHHHHCH | 28.26 | 22668510 | |
| 45 | Phosphorylation | RIAVPSMTSQLSQEC HHHHCHHHHHHCHHH | 20.05 | 22668510 | |
| 67 (in isoform 2) | Acetylation | - | 41.02 | - | |
| 72 (in isoform 2) | Acetylation | - | 7.43 | - | |
| 79 (in isoform 2) | Acetylation | - | 3.85 | - | |
| 88 | Acetylation | LVLKLYDKIDPSKLN HHHHHHHCCCHHHCC | 35.14 | 21791702 | |
| 108 | O-(pantetheine 4'-phosphoryl)serine | INDLGLDSLDHVEVI CCCCCCCCCCCEEEH | 40.51 | - | |
| 108 | Phosphorylation | INDLGLDSLDHVEVI CCCCCCCCCCCEEEH | 40.51 | - | |
| 136 | Acetylation | SDAEKLLKPADIIKY CHHHHHCCHHHHHHH | 48.90 | 21791702 | |
| 142 | Acetylation | LKPADIIKYVADKED CCHHHHHHHHCCHHH | 33.72 | 21791702 | |
| 147 | Acetylation | IIKYVADKEDVYE-- HHHHHCCHHHHCC-- | 46.18 | 21791702 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACPM_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACPM_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACPM_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BCN92_DROME | bcn92 | physical | 22036573 | |
| LIPT2_DROME | CG9804 | physical | 22036573 | |
| MMD4_DROME | mod(mdg4) | physical | 27025476 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...