LIPT2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LIPT2_DROME
• UniProt AC: Q9VN27
• Protein Name: Putative lipoyltransferase 2, mitochondrial
• Gene Name: CG9804
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 234
• Subcellular Localization: Mitochondrion .
• Protein Description: Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (By similarity)..
• Protein Sequence: MPFVRPLVTVVRAGRHSYSAGLQLQQRLARSNQILNPPAEFRNYLVLQEHDPVYTVGLRTKDYTAQDEDRLRRLGADFHRTDRGGLITFHGPGQLVAYPILHLGQFVPSIRWYVATLERMVVEACHQMGISSAKATKDTGIWVGDNKICAIGIHGSRYVTTHGIGLNCCTDLQWFEHIVPCGIEGKGVTSLSKELDRHFPVEEASGALLNSFAKVFECRLQEHAKKPASSAEIG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
131	Phosphorylation	ACHQMGISSAKATKD HHHHCCCCCCEECCC	20.65	22817900
132	Phosphorylation	CHQMGISSAKATKDT HHHCCCCCCEECCCC	31.69	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LIPT2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LIPT2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LIPT2_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of LIPT2_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.