ACMSD_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACMSD_HUMAN
• UniProt AC: Q8TDX5
• Protein Name: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase {ECO:0000303|PubMed:12140278}
• Gene Name: ACMSD
• Organism: Homo sapiens (Human).
• Sequence Length: 336
• Protein Description: Converts alpha-amino-beta-carboxymuconate-epsilon-semialdehyde (ACMS) to alpha-aminomuconate semialdehyde (AMS). ACMS can be converted non-enzymatically to quinolate (QA), a key precursor of NAD, and a potent endogenous excitotoxin of neuronal cells which is implicated in the pathogenesis of various neurodegenerative disorders. In the presence of ACMSD, ACMS is converted to AMS, a benign catabolite. ACMSD ultimately controls the metabolic fate of tryptophan catabolism along the kynurenine pathway..
• Protein Sequence: MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4 (in isoform 2)	Phosphorylation	-	27.34	-
5 (in isoform 2)	Phosphorylation	-	4.01	-
7	Phosphorylation	-MKIDIHSHILPKEW -CCCEECCCCCCCCC	16.74	171589
23 (in isoform 2)	Phosphorylation	-	15.11	-
256	"N6,N6-dimethyllysine"	QDNPMNPKKYLGSFY CCCCCCHHHHCCCHH	49.39	-
256	Methylation	QDNPMNPKKYLGSFY CCCCCCHHHHCCCHH	49.39	23644510

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACMSD_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACMSD_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACMSD_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDK20_HUMAN	CDK20	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.