ACL6B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACL6B_MOUSE
• UniProt AC: Q99MR0
• Protein Name: Actin-like protein 6B
• Gene Name: Actl6b
• Organism: Mus musculus (Mouse).
• Sequence Length: 426
• Subcellular Localization: Nucleus .
• Protein Description: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex), as such plays a role in remodeling mononucleosomes in an ATP-dependent fashion, and is required for postmitotic neural development and dendritic outgrowth. During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. ACTL6B/BAF53B is not essential for assembly of the nBAF complex but is required for targeting the complex and CREST to the promoter of genes essential for dendritic growth..
• Protein Sequence: MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGEKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGGVYGGD ------CCCCCCCCC	44.23	-
83	Phosphorylation	RDGAEVMSPLKNGMI CCCCCCCCCCCCCCC	32.05	-
126	Phosphorylation	MSEAPWNTRAKREKL CCCCCCCHHHHHHHH	28.30	-
216	Ubiquitination	EMAIDIIPPYMIAAK HHHHHHCCHHHEECC	17.82	27667366
240	Ubiquitination	NWKKKEKLPQVSKSW CCCCHHHCCCCCHHH	3.63	27667366
295	Ubiquitination	NGYNTDYGAERLRIP CCCCCCCCCCCCCCC	24.62	27667366
368	Ubiquitination	LNRELSQKTPPSMRL HHHHHHHCCCCHHHE	60.67	27667366
376	Ubiquitination	TPPSMRLKLIASNST CCCHHHEEEHHCCCC	27.73	27667366

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACL6B_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACL6B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACL6B_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMCA4_MOUSE	Smarca4	physical	12368262
SMCA2_MOUSE	Smarca2	physical	12368262

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.