| UniProt ID | ACHA5_MOUSE | |
|---|---|---|
| UniProt AC | Q2MKA5 | |
| Protein Name | Neuronal acetylcholine receptor subunit alpha-5 | |
| Gene Name | Chrna5 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 467 | |
| Subcellular Localization |
Cell junction, synapse, postsynaptic cell membrane Multi-pass membrane protein. Cell membrane Multi-pass membrane protein. |
|
| Protein Description | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.. | |
| Protein Sequence | MAARGSRRRALRLLLMVQLLAGRWRPAGAARGARGGLPELSSAAKHEDSLFRDLFEDYEKWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPCITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAEKDGGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFLLVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Acetylation | LSDKIKIKFGLAISQ HCHHHHHCHHEHHHH | 28.51 | 15621035 | |
| 89 | Acetylation | QLVDVDEKNQLMTTN HHCCCCHHCCEEEEE | 45.59 | 15621045 | |
| 155 | N-linked_Glycosylation | TKTVVRYNGTVTWTQ CEEEEEECCEEEEEC | 29.15 | - | |
| 183 | N-linked_Glycosylation | FFPFDLQNCSMKFGS EECCCCCCCEEEECE | 27.42 | - | |
| 229 | N-linked_Glycosylation | SAMGSKGNRTDSCCW ECCCCCCCCCCCCCC | 47.63 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACHA5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACHA5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACHA5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ACHA4_MOUSE | Chrna4 | physical | 17434683 | |
| ACHA3_MOUSE | Chrna3 | physical | 17434683 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...