| UniProt ID | ABHEB_HUMAN | |
|---|---|---|
| UniProt AC | Q96IU4 | |
| Protein Name | Protein ABHD14B {ECO:0000305} | |
| Gene Name | ABHD14B {ECO:0000312|HGNC:HGNC:28235} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 210 | |
| Subcellular Localization | Cytoplasm. Nucleus. Predominantly cytoplasmic. | |
| Protein Description | Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.. | |
| Protein Sequence | MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAASVEQRE ------CCCCCCCCC | 14.40 | 22814378 | |
| 4 | Phosphorylation | ----MAASVEQREGT ----CCCCCCCCCCE | 19.35 | 28857561 | |
| 34 | Phosphorylation | GSGQARFSVLLLHGI CCCCHHHHHEEEECC | 13.30 | 28857561 | |
| 44 | Phosphorylation | LLHGIRFSSETWQNL EEECCCCCHHHHHHH | 19.88 | 20068231 | |
| 45 | Phosphorylation | LHGIRFSSETWQNLG EECCCCCHHHHHHHH | 36.01 | 20068231 | |
| 47 | Phosphorylation | GIRFSSETWQNLGTL CCCCCHHHHHHHHHH | 34.01 | 20068231 | |
| 53 | Phosphorylation | ETWQNLGTLHRLAQA HHHHHHHHHHHHHHC | 23.66 | 20068231 | |
| 91 | Phosphorylation | IGELAPGSFLAAVVD CCCCCCCCHHHHHHH | 18.94 | 14702039 | |
| 147 | Phosphorylation | DKINAANYASVKTPA CCCCHHHCCCCCCCE | 8.77 | 25884760 | |
| 149 | Phosphorylation | INAANYASVKTPALI CCHHHCCCCCCCEEE | 17.49 | 24114839 | |
| 151 | Ubiquitination | AANYASVKTPALIVY HHHCCCCCCCEEEEE | 46.42 | - | |
| 152 | Phosphorylation | ANYASVKTPALIVYG HHCCCCCCCEEEEEC | 16.19 | 27174698 | |
| 158 | Phosphorylation | KTPALIVYGDQDPMG CCCEEEEECCCCCCC | 14.16 | 27174698 | |
| 164 | Sulfoxidation | VYGDQDPMGQTSFEH EECCCCCCCCCCHHH | 9.27 | 28183972 | |
| 167 | Phosphorylation | DQDPMGQTSFEHLKQ CCCCCCCCCHHHHHC | 29.65 | 27174698 | |
| 168 | Phosphorylation | QDPMGQTSFEHLKQL CCCCCCCCHHHHHCC | 22.28 | 27174698 | |
| 173 | Ubiquitination | QTSFEHLKQLPNHRV CCCHHHHHCCCCCCE | 52.26 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ABHEB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ABHEB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ABHEB_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
