| UniProt ID | ABHD6_HUMAN | |
|---|---|---|
| UniProt AC | Q9BV23 | |
| Protein Name | Monoacylglycerol lipase ABHD6 {ECO:0000305} | |
| Gene Name | ABHD6 {ECO:0000312|HGNC:HGNC:21398} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 337 | |
| Subcellular Localization |
Membrane Single-pass type II membrane protein . Mitochondrion . |
|
| Protein Description | Lipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol. [PubMed: 22969151 Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways. May also have a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids (By similarity] | |
| Protein Sequence | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 126 | Ubiquitination | LSIDGQVKRIHQFVE CCCCCHHHHHHHHHH | 37.43 | 21906983 | |
| 136 | Ubiquitination | HQFVECLKLNKKPFH HHHHHHHHCCCCCEE | 62.77 | - | |
| 189 | Ubiquitination | NQFVQRLKELQGSAA CHHHHHHHHHCCCCC | 59.58 | - | |
| 205 | Phosphorylation | EKIPLIPSTPEEMSE HCCCCCCCCHHHHHH | 49.99 | 24275569 | |
| 223 | Ubiquitination | LCSYVRFKVPQQILQ HHHHHHCCCCHHHHH | 42.30 | - | |
| 265 | Ubiquitination | SLHQNMDKIKVPTQI CHHCCHHCCCCCCEE | 33.39 | - | |
| 267 | Ubiquitination | HQNMDKIKVPTQIIW HCCHHCCCCCCEEEE | 48.15 | - | |
| 276 | Ubiquitination | PTQIIWGKQDQVLDV CCEEEECCCCCEEEC | 35.39 | - | |
| 288 | Sulfoxidation | LDVSGADMLAKSIAN EECCHHHHHHHHHCH | 3.77 | 21406390 | |
| 335 | Ubiquitination | HNTDNNKKLD----- CCCCCCCCCC----- | 61.07 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ABHD6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ABHD6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ABHD6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KCRS_HUMAN | CKMT2 | physical | 21988832 | |
| PCGF2_HUMAN | PCGF2 | physical | 21988832 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
