ABC3F_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ABC3F_HUMAN
• UniProt AC: Q8IUX4
• Protein Name: DNA dC->dU-editing enzyme APOBEC-3F
• Gene Name: APOBEC3F
• Organism: Homo sapiens (Human).
• Sequence Length: 373
• Subcellular Localization: Cytoplasm. Cytoplasm, P-body.
• Protein Description: DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Exhibits antiviral activity also against hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV) and may inhibit the mobility of LTR and non-LTR retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation..
• Protein Sequence: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Phosphorylation	PILSRRNTVWLCYEV CCCCCCCEEEEEEEE	15.96	25159151
136	Methylation	DYRRALCRLSQAGAR HHHHHHHHHHHCCCE	37.92	-
138	Phosphorylation	RRALCRLSQAGARVK HHHHHHHHHCCCEEE	9.91	22210691
161	Phosphorylation	YCWENFVYSEGQPFM HHHHHEEEECCCCCC	9.25	22210691
162	Phosphorylation	CWENFVYSEGQPFMP HHHHEEEECCCCCCC	29.92	22210691
171	Phosphorylation	GQPFMPWYKFDDNYA CCCCCCCEECCCCHH	8.91	22210691
177	Phosphorylation	WYKFDDNYAFLHRTL CEECCCCHHHHHHHH	13.01	-
216	Phosphorylation	KAYGRNESWLCFTME HHHCCCCCEEEEEEE	28.97	-
295	Phosphorylation	AEFLARHSNVNLTIF HHHHHHCCCCEEEEE	36.60	30108239
300	Phosphorylation	RHSNVNLTIFTARLY HCCCCEEEEEEEEEH	14.61	30108239
307	Phosphorylation	TIFTARLYYFWDTDY EEEEEEEHHEECCCH	7.34	24043423
308	Phosphorylation	IFTARLYYFWDTDYQ EEEEEEHHEECCCHH	11.64	24043423
312	Phosphorylation	RLYYFWDTDYQEGLR EEHHEECCCHHHHHH	27.48	24043423
314	Phosphorylation	YYFWDTDYQEGLRSL HHEECCCHHHHHHHH	15.57	24043423
352	Acetylation	YNDDEPFKPWKGLKY CCCCCCCCCCCCCEE	61.76	26051181

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	vif	P69720	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ABC3F_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ABC3F_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VIF_HV1B1	vif	physical	19109396
VIF_HV1BR	vif	physical	19109396
VIF_HV1H2	vif	physical	19109396
VIF_HV1B1	vif	physical	18619467
VIF_HV1BR	vif	physical	18619467
VIF_HV1H2	vif	physical	18619467
VIF_HV1B1	vif	physical	19088851
VIF_HV1BR	vif	physical	19088851
VIF_HV1H2	vif	physical	19088851
VIF_HV1B1	vif	physical	20592083
VIF_HV1BR	vif	physical	20592083
VIF_HV1H2	vif	physical	20592083
VIF_HV1B1	vif	physical	19535447
VIF_HV1BR	vif	physical	19535447
VIF_HV1H2	vif	physical	19535447

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.