UniProt ID | A70A_DROME | |
---|---|---|
UniProt AC | P05623 | |
Protein Name | Accessory gland-specific peptide 70A | |
Gene Name | SP | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 55 | |
Subcellular Localization | Secreted . | |
Protein Description | Male seminal protein which triggers short- and long-term post-mating behavioral responses (PMR) in female Drosophila. [PubMed: 3135120] | |
Protein Sequence | MKTLALFLVLVCVLGLVQSWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Hydroxylation | EWPWNRKPTKFPIPS CCCCCCCCCCCCCCC | 37.27 | 3135120 | |
32 | Hydroxylation | NRKPTKFPIPSPNPR CCCCCCCCCCCCCCC | 38.85 | 3135120 | |
33 | Isoleucine derivative | RKPTKFPIPSPNPRD CCCCCCCCCCCCCCC | 6.25 | - | |
33 | Other | RKPTKFPIPSPNPRD CCCCCCCCCCCCCCC | 6.25 | - | |
34 | Hydroxylation | KPTKFPIPSPNPRDK CCCCCCCCCCCCCCC | 43.93 | 3135120 | |
36 | Hydroxylation | TKFPIPSPNPRDKWC CCCCCCCCCCCCCCC | 49.87 | 3135120 | |
38 | Hydroxylation | FPIPSPNPRDKWCRL CCCCCCCCCCCCCCC | 49.59 | 3135120 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of A70A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of A70A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of A70A_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Hydroxylation | |
Reference | PubMed |
"A male accessory gland peptide that regulates reproductive behaviorof female D. melanogaster."; Chen P.S., Stumm-Zollinger E., Aigaki T., Balmer J., Bienz M.,Boehlen P.; Cell 54:291-298(1988). Cited for: NUCLEOTIDE SEQUENCE [MRNA], AND PROTEIN SEQUENCE OF 20-55. |