dbPTM

A70A_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	A70A_DROME
UniProt AC	P05623
Protein Name	Accessory gland-specific peptide 70A
Gene Name	SP
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	55
Subcellular Localization	Secreted .
Protein Description	Male seminal protein which triggers short- and long-term post-mating behavioral responses (PMR) in female Drosophila. [PubMed: 3135120]
Protein Sequence	MKTLALFLVLVCVLGLVQSWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Hydroxylation	EWPWNRKPTKFPIPS CCCCCCCCCCCCCCC	37.27	3135120
32	Hydroxylation	NRKPTKFPIPSPNPR CCCCCCCCCCCCCCC	38.85	3135120
33	Isoleucine derivative	RKPTKFPIPSPNPRD CCCCCCCCCCCCCCC	6.25	-
33	Other	RKPTKFPIPSPNPRD CCCCCCCCCCCCCCC	6.25	-
34	Hydroxylation	KPTKFPIPSPNPRDK CCCCCCCCCCCCCCC	43.93	3135120
36	Hydroxylation	TKFPIPSPNPRDKWC CCCCCCCCCCCCCCC	49.87	3135120
38	Hydroxylation	FPIPSPNPRDKWCRL CCCCCCCCCCCCCCC	49.59	3135120

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of A70A_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of A70A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of A70A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
DL_DROME	Dl	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of A70A_DROME

Related Literatures of Post-Translational Modification

Hydroxylation
Reference	PubMed
"A male accessory gland peptide that regulates reproductive behaviorof female D. melanogaster."; Chen P.S., Stumm-Zollinger E., Aigaki T., Balmer J., Bienz M.,Boehlen P.; Cell 54:291-298(1988). Cited for: NUCLEOTIDE SEQUENCE [MRNA], AND PROTEIN SEQUENCE OF 20-55.	3135120 [Abstract]