| UniProt ID | A1AT1_MOUSE | |
|---|---|---|
| UniProt AC | P07758 | |
| Protein Name | Alpha-1-antitrypsin 1-1 | |
| Gene Name | Serpina1a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 413 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin.. | |
| Protein Sequence | MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Phosphorylation | DTSQKDQSPASHEIA CCCCCCCCCHHHHHH | 32.35 | 23984901 | |
| 41 | Phosphorylation | QKDQSPASHEIATNL CCCCCCHHHHHHHHH | 25.66 | 27180971 | |
| 46 | Phosphorylation | PASHEIATNLGDFAI CHHHHHHHHHHHHHH | 36.32 | 23984901 | |
| 64 | N-linked_Glycosylation | RELVHQSNTSNIFFS HHHHHHCCCCCCCCC | 40.74 | 17330941 | |
| 101 | N-linked_Glycosylation | ILEGLQFNLTQTSEA HHHHCEECCCCCCHH | 29.26 | 17330941 | |
| 147 | Ubiquitination | NDLKLVEKFLEEAKN CCHHHHHHHHHHHHH | 48.01 | 22790023 | |
| 147 | Acetylation | NDLKLVEKFLEEAKN CCHHHHHHHHHHHHH | 48.01 | 23954790 | |
| 173 | Ubiquitination | AESEEAKKVINDFVE CCCHHHHHHHHHHHH | 56.23 | 22790023 | |
| 181 | Acetylation | VINDFVEKGTQGKIA HHHHHHHHCCCCHHH | 63.05 | 23954790 | |
| 181 | Ubiquitination | VINDFVEKGTQGKIA HHHHHHHHCCCCHHH | 63.05 | - | |
| 181 | Succinylation | VINDFVEKGTQGKIA HHHHHHHHCCCCHHH | 63.05 | 23954790 | |
| 186 | Ubiquitination | VEKGTQGKIAEAVKK HHHCCCCHHHHHHHH | 29.00 | 27667366 | |
| 209 | Ubiquitination | LANYILFKGKWKKPF HHHHHHHCCCCCCCC | 57.02 | 27667366 | |
| 214 | Acetylation | LFKGKWKKPFDPENT HHCCCCCCCCCCCCC | 50.21 | 21728379 | |
| 265 | N-linked_Glycosylation | LLMDYAGNATAVFLL HHECCCCCEEEEEEC | 26.41 | - | |
| 287 | Ubiquitination | HLEQTLSKELISKFL HHHHHHCHHHHHHHH | 60.70 | 22790023 | |
| 292 | Malonylation | LSKELISKFLLNRRR HCHHHHHHHHHHHHH | 32.79 | 25418362 | |
| 292 | Ubiquitination | LSKELISKFLLNRRR HCHHHHHHHHHHHHH | 32.79 | 27667366 | |
| 292 | Acetylation | LSKELISKFLLNRRR HCHHHHHHHHHHHHH | 32.79 | 23864654 | |
| 315 | Ubiquitination | RLSISGEYNLKTLMS CCEECCCCCHHHHCC | 29.35 | 27667366 | |
| 318 | Ubiquitination | ISGEYNLKTLMSPLG ECCCCCHHHHCCCCC | 35.65 | 22790023 | |
| 347 | Ubiquitination | TEENAPLKLSQAVHK CCCCCCHHHHHHHHH | 45.06 | 22790023 | |
| 370 | Ubiquitination | GTEAAAVTVLQMVPM CCHHHHEEEECCCCC | 15.69 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of A1AT1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of A1AT1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of A1AT1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CELA1_MOUSE | Cela1 | physical | 11961105 | |
| ELNE_MOUSE | Elane | physical | 11961105 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides."; Bernhard O.K., Kapp E.A., Simpson R.J.; J. Proteome Res. 6:987-995(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64 AND ASN-101, AND MASSSPECTROMETRY. | |