ELNE_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELNE_MOUSE
• UniProt AC: Q3UP87
• Protein Name: Neutrophil elastase
• Gene Name: Elane
• Organism: Mus musculus (Mouse).
• Sequence Length: 265
• Protein Description: Medullasin modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis (By similarity)..
• Protein Sequence: MALGRLSSRTLAAMLLALFLGGPALASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRSHNDHLLTHPKDREGRTN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MALGRLSSRTLAAM -CCCHHHCHHHHHHH	19.20	23140645
8	Phosphorylation	MALGRLSSRTLAAML CCCHHHCHHHHHHHH	33.60	23140645
123	N-linked_Glycosylation	DIVIIQLNGSATINA CEEEEEECCCEEECC	26.46	-
172	N-linked_Glycosylation	PSVLQELNVTVVTNM HHHHHHCCEEEHHHH	27.02	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELNE_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELNE_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELNE_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ELNE_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.