UniProt ID | 7B2_HUMAN | |
---|---|---|
UniProt AC | P05408 | |
Protein Name | Neuroendocrine protein 7B2 | |
Gene Name | SCG5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 212 | |
Subcellular Localization | Secreted. Neuroendocrine and endocrine secretory granules. | |
Protein Description | Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.. | |
Protein Sequence | MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MVSRMVSTML -----CHHHHHHHHH | 17.23 | 22210691 | |
7 | Phosphorylation | -MVSRMVSTMLSGLL -CHHHHHHHHHHHHH | 9.96 | 22210691 | |
11 | Phosphorylation | RMVSTMLSGLLFWLA HHHHHHHHHHHHHHH | 19.30 | 24719451 | |
19 | Phosphorylation | GLLFWLASGWTPAFA HHHHHHHHCCCCCHH | 32.47 | 22210691 | |
28 | Phosphorylation | WTPAFAYSPRTPDRV CCCCHHCCCCCCCCC | 12.41 | 24719451 | |
108 | Phosphorylation | DNIPKDFSEDQGYPD CCCCCCCCCCCCCCC | 50.85 | 26657352 | |
133 (in isoform 2) | Phosphorylation | - | 43.92 | 29691806 | |
136 (in isoform 2) | Phosphorylation | - | 57.41 | 26657352 | |
137 | Phosphorylation | CLENTPDTAEFSREF CCCCCCCHHHHHHHH | 29.32 | 26657352 | |
140 (in isoform 2) | Phosphorylation | - | 8.49 | 29691806 | |
141 | Phosphorylation | TPDTAEFSREFQLHQ CCCHHHHHHHHCHHH | 23.54 | - | |
166 | Ubiquitination | GLGKWNKKLLYEKMK CCCHHHHHHHHHHHC | 40.28 | - | |
200 | Phosphorylation | DNVVAKKSVPHFSDE CCCHHCCCCCCCCCC | 39.93 | 25332170 | |
205 | Phosphorylation | KKSVPHFSDEDKDPE CCCCCCCCCCCCCCC | 36.74 | 26657352 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 7B2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 7B2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 7B2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBQL4_HUMAN | UBQLN4 | physical | 16169070 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...