| UniProt ID | ZWINT_RAT | |
|---|---|---|
| UniProt AC | Q8VIL3 | |
| Protein Name | ZW10 interactor | |
| Gene Name | Zwint | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 266 | |
| Subcellular Localization | Nucleus. Chromosome, centromere, kinetochore. Localizes to kinetochores from late prophase to anaphase.. | |
| Protein Description | Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase (By similarity).. | |
| Protein Sequence | MADAEKNAVAEKNAVAEENAVAEENAVADKNATKEVLAEAASVLEPVGLPEEAELPAKIMEEFMRNSRKKDKLLCSQLQVVNFLQTFLAQEDNTDQNPDALASEDTSRQKATETKEQWKELKATYMDHVDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWVLQQKRLQNLTKISAEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRNQSYLQLLCSLQNKLVISESKADDKDVKGPALPPKSP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Acetylation | --MADAEKNAVAEKN --CCHHHHHHHHHHH | 52.51 | 22902405 | |
| 124 | Phosphorylation | QWKELKATYMDHVDV HHHHHHHHHHCHHHH | 20.14 | 22276854 | |
| 125 | Phosphorylation | WKELKATYMDHVDVI HHHHHHHHHCHHHHH | 12.85 | - | |
| 163 | Ubiquitination | AFEQLEAKKRVLEEK HHHHHHHHHHHHHHH | 31.56 | - | |
| 176 | Ubiquitination | EKLQLAQKQWVLQQK HHHHHHHHHHHHHHH | 40.29 | - | |
| 209 | Phosphorylation | ALEKLDGSHQELETL HHHHHCCCHHHHHHH | 22.97 | 27097102 | |
| 232 | Phosphorylation | EKLQRNQSYLQLLCS HHHHHCHHHHHHHHH | 31.21 | 28689409 | |
| 233 | Phosphorylation | KLQRNQSYLQLLCSL HHHHCHHHHHHHHHH | 6.68 | 27097102 | |
| 239 | Phosphorylation | SYLQLLCSLQNKLVI HHHHHHHHHHCCCCC | 32.72 | 27097102 | |
| 265 | Phosphorylation | GPALPPKSP------ CCCCCCCCC------ | 41.43 | 28689409 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZWINT_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZWINT_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZWINT_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZWINT_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...