| UniProt ID | ZNF80_HUMAN | |
|---|---|---|
| UniProt AC | P51504 | |
| Protein Name | Zinc finger protein 80 | |
| Gene Name | ZNF80 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 273 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MSPKRDGLGTGDGLHSQVLQEQVSTGDNLHECDSQGPSKDTLVREGKTYKCKECGSVFNKNSLLVRHQQIHTGVKPYECQECGKAFPEKVDFVRPMRIHTGEKPCKCVECGKVFNRRSHLLCYRQIHTGEKPYECSECGKTFSYHSVFIQHRVTHTGEKLFGCKECGKTFYYNSSLTRHMKIHTGEKPCKCSECGKTFTYRSVFFRHSMTHTAGKPYECKECGKGFYYSYSLTRHTRSHTGEKPYECLEHRKDFGYHSAFAQQSKIHSGGKNL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 62 | Phosphorylation | GSVFNKNSLLVRHQQ CCEECCCCEEEEEEE | 25.37 | 24719451 | |
| 100 | Phosphorylation | VRPMRIHTGEKPCKC ECCEEEECCCCCEEE | 44.67 | 24719451 | |
| 118 | Phosphorylation | GKVFNRRSHLLCYRQ CCEECCCCCEEEEEE | 18.43 | 24043423 | |
| 123 | Phosphorylation | RRSHLLCYRQIHTGE CCCCEEEEEEEECCC | 12.91 | 24043423 | |
| 128 | Phosphorylation | LCYRQIHTGEKPYEC EEEEEEECCCCCEEE | 48.98 | 29496963 | |
| 133 | Phosphorylation | IHTGEKPYECSECGK EECCCCCEEECCCCC | 40.41 | - | |
| 136 | Phosphorylation | GEKPYECSECGKTFS CCCCEEECCCCCEEE | 24.79 | 27251275 | |
| 192 | Phosphorylation | GEKPCKCSECGKTFT CCCCEEECCCCCEEE | 22.78 | - | |
| 197 | Phosphorylation | KCSECGKTFTYRSVF EECCCCCEEEEEEEE | 13.39 | - | |
| 199 | Phosphorylation | SECGKTFTYRSVFFR CCCCCEEEEEEEEEE | 24.21 | - | |
| 200 | Phosphorylation | ECGKTFTYRSVFFRH CCCCEEEEEEEEEEC | 9.19 | - | |
| 220 | Sumoylation | AGKPYECKECGKGFY CCCCEECCCCCCEEE | 44.06 | - | |
| 220 | Sumoylation | AGKPYECKECGKGFY CCCCEECCCCCCEEE | 44.06 | - | |
| 227 | Phosphorylation | KECGKGFYYSYSLTR CCCCCEEEEEEECCC | 10.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZNF80_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZNF80_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZNF80_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZNF80_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
