dbPTM

ZNF2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ZNF2_MOUSE
UniProt AC	Q8BIQ3
Protein Name	Zinc finger protein 2
Gene Name	Znf2
Organism	Mus musculus (Mouse).
Sequence Length	427
Subcellular Localization	Nucleus .
Protein Description	May be involved in transcriptional regulation..
Protein Sequence	MAAVSPPTRCQALVTFEDVAVTFTDDEWKRLVPVQRALYKAVMLENYESIISLGLPVPRPDVILQFKRRGEPWIRGFHGSEEKTWPESVSLDLETKPETLDASRGTLREIHRKQSSLCPKREIQTLTGGPEPEKESPKARTCKKPLSLDKGLHQMSAPSKKALTKHQDQECSECGKTFFDHSSLIRHQRTHTGEKPYDCPECGKAFSHRSSLSRHLMFHTGESPYECDACGKAFFDRSSLTVHQRIHTGEKPFKCNDCGKAFFDRSSLTRHQRIHTGESPYECQQCGKAFSQKSILTRHLLTHTGRKPYECRDCGKAFYGVTSLNRHQKVHTEEPRYQCSECGKAFFDRSSLTQHQKIHTGDKPYECGECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKEFSSKSSIIQHQRRYAKQGIDRGGSMS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
127	Phosphorylation	KREIQTLTGGPEPEK HHHHHHHCCCCCCCC	43.40	28285833
136	Phosphorylation	GPEPEKESPKARTCK CCCCCCCCCCCCCCC	42.65	28066266
210	Phosphorylation	GKAFSHRSSLSRHLM CHHCCCCHHHHHHHC	30.15	22324799
211	Phosphorylation	KAFSHRSSLSRHLMF HHCCCCHHHHHHHCE	30.26	23140645
213	Phosphorylation	FSHRSSLSRHLMFHT CCCCHHHHHHHCEEC	21.43	22324799
248	Phosphorylation	TVHQRIHTGEKPFKC EEECCCCCCCCCEEC	44.67	-
294	Phosphorylation	GKAFSQKSILTRHLL CHHHHHHHHHHHHHH	18.39	24719451
323	Phosphorylation	KAFYGVTSLNRHQKV HHEECCCCCCCCCCC	22.65	28059163
388	Phosphorylation	TRHQRVHTGEKPFEC CCCCCCCCCCCCEEE	44.15	23140645

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ZNF2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ZNF2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ZNF2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ZNF2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ZNF2_MOUSE

Related Literatures of Post-Translational Modification