| UniProt ID | ZN784_HUMAN | |
|---|---|---|
| UniProt AC | Q8NCA9 | |
| Protein Name | Zinc finger protein 784 | |
| Gene Name | ZNF784 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 323 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MAAARPEAQSRSSPTPESRSQEPLDLVLVPDDCRPGTPPSDLIEIQVVKVTDTTLVPEPPEPGSFHCALCPAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFHGPGPGLGDSGGQLGSSAAEGSGSGCGVGDPAEEGRGETAKVKVEADQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | AARPEAQSRSSPTPE CCCHHHHCCCCCCCC | 40.97 | 22199227 | |
| 12 | Phosphorylation | RPEAQSRSSPTPESR CHHHHCCCCCCCCCC | 46.01 | 33259812 | |
| 13 | Phosphorylation | PEAQSRSSPTPESRS HHHHCCCCCCCCCCC | 31.51 | 25159151 | |
| 15 | Phosphorylation | AQSRSSPTPESRSQE HHCCCCCCCCCCCCC | 41.45 | 22199227 | |
| 18 | Phosphorylation | RSSPTPESRSQEPLD CCCCCCCCCCCCCCC | 38.13 | 22199227 | |
| 37 | Phosphorylation | PDDCRPGTPPSDLIE CCCCCCCCCCHHCEE | 34.41 | 25849741 | |
| 40 | Phosphorylation | CRPGTPPSDLIEIQV CCCCCCCHHCEEEEE | 46.37 | 26074081 | |
| 120 | Phosphorylation | PASLRAHYSLHTGER CHHHHHEEEEECCCC | 16.37 | 28555341 | |
| 121 | Phosphorylation | ASLRAHYSLHTGERP HHHHHEEEEECCCCC | 12.10 | 29214152 | |
| 124 | Phosphorylation | RAHYSLHTGERPYRC HHEEEEECCCCCCEE | 46.13 | 28555341 | |
| 158 | Phosphorylation | HGVEPGTSRRPPDTA CCCCCCCCCCCCCHH | 32.01 | 28348404 | |
| 208 | Phosphorylation | CAKPFRRSSDMRDHE CCCCCCCCCCCCCCC | 26.83 | 20166139 | |
| 219 | Phosphorylation | RDHERVHTGERPYHC CCCCCCCCCCCCCCC | 37.57 | 29214152 | |
| 247 | Phosphorylation | SGHARIHTGERPFRC CCCCEEECCCCCEEE | 38.06 | 23186163 | |
| 273 | Phosphorylation | NFRKHQRTHFHGPGP CCHHHCCCCCCCCCC | 23.48 | - | |
| 318 | Sumoylation | RGETAKVKVEADQ-- CCCCEEEEEECCC-- | 33.38 | - | |
| 318 | Sumoylation | RGETAKVKVEADQ-- CCCCEEEEEECCC-- | 33.38 | 28112733 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN784_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN784_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN784_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZN784_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
