| UniProt ID | ZN716_HUMAN | |
|---|---|---|
| UniProt AC | A6NP11 | |
| Protein Name | Zinc finger protein 716 | |
| Gene Name | ZNF716 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 495 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MAKRPGPPGSREMGLLTFRDIAIEFSLAEWQCLDHAQQNLYRDVMLENYRNLVSLGIAVSKPDLITCLEQNKEPQNIKRNEMVAKHPVTCSHFTQDLQSEQGIKDSLQKVILRRYGKCGQEDLQVKKCCKSVGECEVHKGGYNYVNQCLSATQNKTFQTHKCVKVFGKFSNSNRHKTRHTGKKHFKCKNDGKSFCMLSRLNQHQIIHTREKSYKCEECGKSFNCSSTLTRHKRIHTGEKPYRCEECGKAFSWSASLTKHKRIHTGEKPYTCEERGKVFSRSTLTNYKRIHTGEKPYTCEECGKAFSRSSTLTNHKRIHTGERPYKCEECGKAFSLSSTLKKHKIVHTGEKLYTCEECGKAFTFSSTLNTHKRIHTGEKPYTCEECGKAFSLPSTFTYHKRTHTGEKPYKCEECGKAFNCSSTLKKHKIIHTGEKLYKCKECGKAFTFSSTLNTHKRIHTGEKPYKCEECDQTFKWHSSLANHKNMHTGEKPYKYE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | KRPGPPGSREMGLLT CCCCCCCCHHCCEEE | 30.73 | 24719451 | |
| 170 | Phosphorylation | VKVFGKFSNSNRHKT HEEEEECCCCCCCCC | 42.72 | 26552605 | |
| 172 | Phosphorylation | VFGKFSNSNRHKTRH EEEECCCCCCCCCCC | 33.76 | 26552605 | |
| 177 | Phosphorylation | SNSNRHKTRHTGKKH CCCCCCCCCCCCCCC | 22.89 | 26552605 | |
| 213 | Phosphorylation | IHTREKSYKCEECGK EEECCCEEECCCCCC | 30.63 | 18083107 | |
| 214 | Sumoylation | HTREKSYKCEECGKS EECCCEEECCCCCCC | 42.11 | - | |
| 214 | Sumoylation | HTREKSYKCEECGKS EECCCEEECCCCCCC | 42.11 | - | |
| 225 | Phosphorylation | CGKSFNCSSTLTRHK CCCCCCCCCCCCCCC | 27.71 | - | |
| 226 | Phosphorylation | GKSFNCSSTLTRHKR CCCCCCCCCCCCCCC | 29.63 | - | |
| 229 | Phosphorylation | FNCSSTLTRHKRIHT CCCCCCCCCCCCCCC | 30.71 | - | |
| 236 | Phosphorylation | TRHKRIHTGEKPYRC CCCCCCCCCCCCEEC | 44.67 | 29496963 | |
| 239 | Ubiquitination | KRIHTGEKPYRCEEC CCCCCCCCCEECCCC | 49.01 | 29967540 | |
| 239 | Sumoylation | KRIHTGEKPYRCEEC CCCCCCCCCEECCCC | 49.01 | - | |
| 239 | Sumoylation | KRIHTGEKPYRCEEC CCCCCCCCCEECCCC | 49.01 | - | |
| 264 | Phosphorylation | TKHKRIHTGEKPYTC CCCCCCCCCCCCEEH | 44.67 | 20736484 | |
| 291 | Phosphorylation | TNYKRIHTGEKPYTC CCCCCCCCCCCCEEH | 44.67 | 20736484 | |
| 308 | Phosphorylation | CGKAFSRSSTLTNHK HHCCCCCCCCCCCCC | 26.86 | 24719451 | |
| 309 | Phosphorylation | GKAFSRSSTLTNHKR HCCCCCCCCCCCCCC | 26.73 | 24719451 | |
| 310 | Phosphorylation | KAFSRSSTLTNHKRI CCCCCCCCCCCCCCC | 38.56 | - | |
| 319 | Phosphorylation | TNHKRIHTGERPYKC CCCCCCCCCCCCEEC | 38.06 | 24719451 | |
| 325 | Sumoylation | HTGERPYKCEECGKA CCCCCCEECHHCCCE | 37.54 | - | |
| 325 | Ubiquitination | HTGERPYKCEECGKA CCCCCCEECHHCCCE | 37.54 | - | |
| 325 | Sumoylation | HTGERPYKCEECGKA CCCCCCEECHHCCCE | 37.54 | - | |
| 375 | Phosphorylation | NTHKRIHTGEKPYTC CCCCCEECCCCCEEC | 44.67 | 20736484 | |
| 401 | Phosphorylation | TFTYHKRTHTGEKPY EEEEECCCCCCCCCE | 28.70 | 28348404 | |
| 403 | Phosphorylation | TYHKRTHTGEKPYKC EEECCCCCCCCCEEC | 46.56 | 26270265 | |
| 406 | Ubiquitination | KRTHTGEKPYKCEEC CCCCCCCCCEECCCC | 55.80 | - | |
| 408 | Phosphorylation | THTGEKPYKCEECGK CCCCCCCEECCCCCC | 39.06 | - | |
| 409 | Sumoylation | HTGEKPYKCEECGKA CCCCCCEECCCCCCC | 43.63 | - | |
| 409 | Sumoylation | HTGEKPYKCEECGKA CCCCCCEECCCCCCC | 43.63 | - | |
| 409 | Ubiquitination | HTGEKPYKCEECGKA CCCCCCEECCCCCCC | 43.63 | - | |
| 431 | Phosphorylation | KKHKIIHTGEKLYKC CCCCEEECCCEEEEC | 36.31 | 27251275 | |
| 436 | Phosphorylation | IHTGEKLYKCKECGK EECCCEEEECCCCCC | 25.96 | 26074081 | |
| 446 | Phosphorylation | KECGKAFTFSSTLNT CCCCCEEEEECCCCC | 27.71 | 26074081 | |
| 448 | Phosphorylation | CGKAFTFSSTLNTHK CCCEEEEECCCCCCC | 21.25 | 26074081 | |
| 449 | Phosphorylation | GKAFTFSSTLNTHKR CCEEEEECCCCCCCC | 32.49 | 26074081 | |
| 450 | Phosphorylation | KAFTFSSTLNTHKRI CEEEEECCCCCCCCC | 23.87 | 26074081 | |
| 453 | Phosphorylation | TFSSTLNTHKRIHTG EEECCCCCCCCCCCC | 31.70 | 26074081 | |
| 459 | Phosphorylation | NTHKRIHTGEKPYKC CCCCCCCCCCCCCCC | 44.67 | 29496963 | |
| 464 | Phosphorylation | IHTGEKPYKCEECDQ CCCCCCCCCCCCCCC | 39.06 | 26074081 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN716_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN716_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN716_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZN716_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
