dbPTM

ZN688_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ZN688_HUMAN
UniProt AC	P0C7X2
Protein Name	Zinc finger protein 688
Gene Name	ZNF688
Organism	Homo sapiens (Human).
Sequence Length	276
Subcellular Localization	Nucleus .
Protein Description	May be involved in transcriptional regulation..
Protein Sequence	MAPPPAPLLAPRPGETRPGCRKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYGHLGALGFPGPKPALISWMEQESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8 (in isoform 5)	Phosphorylation	-	7.47	-
9 (in isoform 5)	Phosphorylation	-	6.33	-
131	Phosphorylation	RKAPVKESPEVLVER CCCCCCCCCCEEECC	22.20	25262027
145	Phosphorylation	RNPDPAISVAPARAQ CCCCCCCEECCCCCC	17.84	24719451
186	Phosphorylation	GQRRHVCTDCGRRFT CCCCEEECCCCCCCC	32.98	22210691
193	Phosphorylation	TDCGRRFTYPSLLVS CCCCCCCCCCHHHEE	32.48	27251275
206	Phosphorylation	VSHRRMHSGERPFPC EECCCCCCCCCCCCC	32.76	28555341
234	Methylation	EAHQWIHRSCSGGRR HHHHHHHHHCCCCCC	30.17	115920593
256	Methylation	AVPRAPVRGDRDPPV EECCCCCCCCCCCCC	39.99	115920597

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ZN688_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ZN688_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ZN688_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ZN688_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ZN688_HUMAN

Related Literatures of Post-Translational Modification