| UniProt ID | ZN641_HUMAN | |
|---|---|---|
| UniProt AC | Q96N77 | |
| Protein Name | Zinc finger protein 641 | |
| Gene Name | ZNF641 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 438 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional activator. Activates transcriptional activities of SRE and AP-1.. | |
| Protein Sequence | MQAEDRSQFGSAAEMLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKTFGRRHHLIRHQKTHLHDKTSRCSECGKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGTRKRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSVF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 129 | Phosphorylation | EWRSLDPSQTDFYGE HHHCCCHHHCCCHHH | 45.43 | - | |
| 168 | Phosphorylation | QLEGGEEQWVPDPQD HCCCCCCCCCCCHHH | 42.01 | 33259812 | |
| 177 | Phosphorylation | VPDPQDLEERDILRV CCCHHHCCCCCEEEE | 60.31 | 33259812 | |
| 185 | Phosphorylation | ERDILRVTYTGDGSE CCCEEEEEECCCCCC | 14.66 | 30266825 | |
| 186 | Phosphorylation | RDILRVTYTGDGSEH CCEEEEEECCCCCCC | 13.08 | 30108239 | |
| 187 | Phosphorylation | DILRVTYTGDGSEHE CEEEEEECCCCCCCC | 21.30 | 30266825 | |
| 191 | Phosphorylation | VTYTGDGSEHEGDTP EEECCCCCCCCCCCC | 40.29 | 30266825 | |
| 197 | Phosphorylation | GSEHEGDTPELEAEP CCCCCCCCCCCCCCC | 29.53 | 30108239 | |
| 233 | Phosphorylation | WDSMPSSSRGMLLGP CCCCCCCCCCCCCCC | 36.87 | - | |
| 259 | Phosphorylation | LCSTEMDSLLRPHTC EECCCHHHHCCCCCC | 28.17 | 24719451 | |
| 349 | Acetylation | HAEGKSCKGQEVGES ECCCCCCCCCCCCCC | 71.38 | 19810291 | |
| 356 | Phosphorylation | KGQEVGESPGTRKRQ CCCCCCCCCCCCCCC | 23.77 | 21815630 | |
| 359 | Phosphorylation | EVGESPGTRKRQRAP CCCCCCCCCCCCCCC | 36.08 | 28122231 | |
| 421 | Phosphorylation | HLDRHLLTHQGQSPR HHHHHHHHCCCCCCC | 20.65 | 27732954 | |
| 426 | Phosphorylation | LLTHQGQSPRNSWDR HHHCCCCCCCCCCCC | 32.43 | 30266825 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN641_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN641_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN641_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KDM1A_HUMAN | KDM1A | physical | 23455924 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
