ZN593_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZN593_DROME
• UniProt AC: Q9W3Y0
• Protein Name: Zinc finger protein 593 homolog
• Gene Name: CG3224
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 162
• Protein Sequence: MGMVSKRKKMHYGDTHLQRRWRVRNRRRDLDQIDDDLQTRSGELINQNVDLDKPGFAQFYCVHCAKYFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEAERAAGRGSFVKPKKRAMETQPSKEDVVAGKRIRVEVVPEDTDATDSPSTSKTKRKKVEKMET

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
80	Phosphorylation	AMQAHFRTKVHKRRL HHHHHHHHHHHHHHH	36.15	22817900
122	Phosphorylation	RAMETQPSKEDVVAG CCCCCCCCHHHHHCC	38.57	21082442
130	Acetylation	KEDVVAGKRIRVEVV HHHHHCCCEEEEEEC	34.61	21791702
146	Phosphorylation	EDTDATDSPSTSKTK CCCCCCCCCCCCHHH	19.18	22668510

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZN593_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZN593_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZN593_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.