dbPTM

ZN346_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ZN346_MOUSE
UniProt AC	Q9R0B7
Protein Name	Zinc finger protein 346
Gene Name	Znf346
Organism	Mus musculus (Mouse).
Sequence Length	294
Subcellular Localization	Nucleus, nucleolus. Cytoplasm. Nuclear at steady state, primarily in the nucleolus. Shuttles between the nucleus and cytoplasm when associated with XPO5 (By similarity)..
Protein Description	Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity (By similarity). [PubMed: 10488071 May bind to specific miRNA hairpins (By similarity]
Protein Sequence	MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MECPAPDA -------CCCCCCCC	12.34	-
104	Phosphorylation	HANKVKRYLAIHGME HHHHHHHHHHHHCCC	8.51	-
127	Phosphorylation	LDSDQKSSRSKDKNH CCCCCCCCCCCCCCC	47.83	22982522
270	Phosphorylation	HKNQSPKTLVTLGSQ CCCCCCCEEEECCCC	29.82	25777480
273	Phosphorylation	QSPKTLVTLGSQTPV CCCCEEEECCCCCCC	28.63	26745281
276	Phosphorylation	KTLVTLGSQTPVQTQ CEEEECCCCCCCCCC	33.71	26745281
278	Phosphorylation	LVTLGSQTPVQTQPT EEECCCCCCCCCCCC	27.42	26745281
282	Phosphorylation	GSQTPVQTQPTPKDS CCCCCCCCCCCCCCC	36.43	28066266
285	Phosphorylation	TPVQTQPTPKDSSTV CCCCCCCCCCCCCCC	32.90	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ZN346_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ZN346_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ZN346_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ZN346_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ZN346_MOUSE

Related Literatures of Post-Translational Modification