UniProt ID | ZN195_HUMAN | |
---|---|---|
UniProt AC | O14628 | |
Protein Name | Zinc finger protein 195 | |
Gene Name | ZNF195 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 629 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVKRQEAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSVDKFTALCSPGVLQTVKWFLEFRCIFSLAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGLDNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNFSNLHRRNISNTGEKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEPENIDTGEKPYKCQECNNVIKTCSVLTKNRIYAGGEHYRCEEFGKVFNQCSHLTEHEHGTEEKPCKYEECSSVFISCSSLSNQQMILAGEKLSKCETWYKGFNHSPNPSKHQRNEIGGKPFKCEECDSIFKWFSDLTKHKRIHTGEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSSLSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEKCGKAFTQFSHLTVHESIHT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTLLTFRDV ------CCEEEHHHH | 30.40 | 22798277 | |
14 | Phosphorylation | RDVAIEFSLEEWKCL HHHHHEECHHHHHHH | 23.29 | 25159151 | |
60 | Ubiquitination | ITCLEQRKEPWNVKR HHHHHHCCCCCCCCH | 68.75 | 29967540 | |
64 | Ubiquitination | EQRKEPWNVKRQEAA HHCCCCCCCCHHHHH | 39.90 | 29967540 | |
64 (in isoform 7) | Ubiquitination | - | 39.90 | - | |
66 | Ubiquitination | RKEPWNVKRQEAADG CCCCCCCCHHHHHCC | 45.19 | - | |
70 (in isoform 7) | Ubiquitination | - | 11.52 | - | |
80 | Ubiquitination | GHPEMGFHHATQACL CCCCCCHHHHHHHHH | 12.16 | 22817900 | |
83 | Ubiquitination | EMGFHHATQACLELL CCCHHHHHHHHHHHH | 16.61 | 21890473 | |
97 | Ubiquitination | LGSSDLPASASQSAG HCCCCCCCCHHHHCC | 25.65 | 29967540 | |
101 | Ubiquitination | DLPASASQSAGITGV CCCCCHHHHCCCCCC | 36.70 | 29967540 | |
101 (in isoform 7) | Ubiquitination | - | 36.70 | - | |
115 | Ubiquitination | VNHRAQPGLNVSVDK CCCCCCCCCCEEHHH | 20.15 | 29967540 | |
119 | Ubiquitination | AQPGLNVSVDKFTAL CCCCCCEEHHHHHHH | 24.43 | 29967540 | |
119 (in isoform 7) | Ubiquitination | - | 24.43 | - | |
121 | Ubiquitination | PGLNVSVDKFTALCS CCCCEEHHHHHHHCC | 32.61 | 22817900 | |
124 | Ubiquitination | NVSVDKFTALCSPGV CEEHHHHHHHCCHHH | 25.18 | 21890473 | |
127 | Ubiquitination | VDKFTALCSPGVLQT HHHHHHHCCHHHHHH | 4.23 | 29967540 | |
128 | Ubiquitination | DKFTALCSPGVLQTV HHHHHHCCHHHHHHH | 26.07 | 29967540 | |
128 (in isoform 7) | Ubiquitination | - | 26.07 | - | |
131 | Ubiquitination | TALCSPGVLQTVKWF HHHCCHHHHHHHHHH | 3.98 | 29967540 | |
131 (in isoform 7) | Ubiquitination | - | 3.98 | - | |
132 | Ubiquitination | ALCSPGVLQTVKWFL HHCCHHHHHHHHHHH | 4.35 | 29967540 | |
142 | Ubiquitination | VKWFLEFRCIFSLAM HHHHHHHHHHHHHHH | 11.84 | 29967540 | |
144 | Ubiquitination | WFLEFRCIFSLAMSS HHHHHHHHHHHHHHC | 1.98 | 22817900 | |
146 | Ubiquitination | LEFRCIFSLAMSSHF HHHHHHHHHHHHCCC | 8.70 | 29967540 | |
146 (in isoform 7) | Ubiquitination | - | 8.70 | - | |
147 | Ubiquitination | EFRCIFSLAMSSHFT HHHHHHHHHHHCCCH | 3.01 | 21890473 | |
148 | Ubiquitination | FRCIFSLAMSSHFTQ HHHHHHHHHHCCCHH | 8.46 | 22817900 | |
150 | Ubiquitination | CIFSLAMSSHFTQDL HHHHHHHHCCCHHHC | 18.30 | 29967540 | |
151 | Ubiquitination | IFSLAMSSHFTQDLL HHHHHHHCCCHHHCC | 14.99 | 21890473 | |
151 (in isoform 4) | Ubiquitination | - | 14.99 | 21890473 | |
152 | Ubiquitination | FSLAMSSHFTQDLLP HHHHHHCCCHHHCCC | 23.59 | 22817900 | |
152 (in isoform 7) | Ubiquitination | - | 23.59 | - | |
154 | Ubiquitination | LAMSSHFTQDLLPEQ HHHHCCCHHHCCCHH | 18.75 | 29967540 | |
155 | Ubiquitination | AMSSHFTQDLLPEQG HHHCCCHHHCCCHHC | 38.11 | 21890473 | |
155 | Ubiquitination | AMSSHFTQDLLPEQG HHHCCCHHHCCCHHC | 38.11 | 21890473 | |
155 (in isoform 7) | Ubiquitination | - | 38.11 | 21890473 | |
159 | Ubiquitination | HFTQDLLPEQGIQDA CCHHHCCCHHCCCHH | 38.88 | 29967540 | |
162 | Ubiquitination | QDLLPEQGIQDAFPK HHCCCHHCCCHHCCH | 20.19 | 29967540 | |
163 | Ubiquitination | DLLPEQGIQDAFPKR HCCCHHCCCHHCCHH | 3.15 | 22817900 | |
164 | Ubiquitination | LLPEQGIQDAFPKRI CCCHHCCCHHCCHHH | 42.69 | 29967540 | |
166 | Ubiquitination | PEQGIQDAFPKRILR CHHCCCHHCCHHHHH | 13.28 | 21890473 | |
168 | Ubiquitination | QGIQDAFPKRILRGY HCCCHHCCHHHHHCC | 27.08 | 29967540 | |
169 | Ubiquitination | GIQDAFPKRILRGYG CCCHHCCHHHHHCCC | 45.69 | 29967540 | |
170 | Ubiquitination | IQDAFPKRILRGYGN CCHHCCHHHHHCCCC | 33.15 | 29967540 | |
173 | Ubiquitination | AFPKRILRGYGNCGL HCCHHHHHCCCCCCC | 33.64 | 29967540 | |
174 | Ubiquitination | FPKRILRGYGNCGLD CCHHHHHCCCCCCCC | 31.11 | 29967540 | |
174 (in isoform 7) | Ubiquitination | - | 31.11 | - | |
175 | Ubiquitination | PKRILRGYGNCGLDN CHHHHHCCCCCCCCC | 9.95 | 22817900 | |
176 | Ubiquitination | KRILRGYGNCGLDNL HHHHHCCCCCCCCCE | 26.27 | 29967540 | |
177 | Ubiquitination | RILRGYGNCGLDNLY HHHHCCCCCCCCCEE | 14.27 | 29967540 | |
177 (in isoform 7) | Ubiquitination | - | 14.27 | - | |
178 | Ubiquitination | ILRGYGNCGLDNLYL HHHCCCCCCCCCEEE | 5.07 | 21890473 | |
180 | Ubiquitination | RGYGNCGLDNLYLRK HCCCCCCCCCEEECC | 4.26 | 29967540 | |
183 | Ubiquitination | GNCGLDNLYLRKDWE CCCCCCCEEECCCHH | 4.21 | 22817900 | |
184 | Phosphorylation | NCGLDNLYLRKDWES CCCCCCEEECCCHHH | 15.66 | 17360941 | |
186 | Ubiquitination | GLDNLYLRKDWESLD CCCCEEECCCHHHHH | 22.72 | 21890473 | |
187 | Ubiquitination | LDNLYLRKDWESLDE CCCEEECCCHHHHHH | 65.68 | 29967540 | |
189 | Ubiquitination | NLYLRKDWESLDECK CEEECCCHHHHHHHC | 10.50 | 21890473 | |
191 | Ubiquitination | YLRKDWESLDECKLQ EECCCHHHHHHHCCC | 36.55 | 29967540 | |
195 | Ubiquitination | DWESLDECKLQKDYN CHHHHHHHCCCCCCC | 5.49 | 29967540 | |
196 | Sumoylation | WESLDECKLQKDYNG HHHHHHHCCCCCCCC | 52.48 | - | |
196 | Ubiquitination | WESLDECKLQKDYNG HHHHHHHCCCCCCCC | 52.48 | 29967540 | |
196 | Sumoylation | WESLDECKLQKDYNG HHHHHHHCCCCCCCC | 52.48 | - | |
197 | Ubiquitination | ESLDECKLQKDYNGL HHHHHHCCCCCCCCC | 13.31 | 22817900 | |
199 | Ubiquitination | LDECKLQKDYNGLNQ HHHHCCCCCCCCCCC | 73.03 | 29967540 | |
200 | Ubiquitination | DECKLQKDYNGLNQC HHHCCCCCCCCCCCC | 29.21 | 21890473 | |
200 (in isoform 5) | Ubiquitination | - | 29.21 | 21890473 | |
201 | Ubiquitination | ECKLQKDYNGLNQCS HHCCCCCCCCCCCCC | 20.40 | 22817900 | |
201 | Phosphorylation | ECKLQKDYNGLNQCS HHCCCCCCCCCCCCC | 20.40 | 29496907 | |
204 | Ubiquitination | LQKDYNGLNQCSSTT CCCCCCCCCCCCCCC | 3.40 | 21890473 | |
204 (in isoform 6) | Ubiquitination | - | 3.40 | 21890473 | |
205 | Ubiquitination | QKDYNGLNQCSSTTH CCCCCCCCCCCCCCH | 42.06 | 29967540 | |
208 | Ubiquitination | YNGLNQCSSTTHSKI CCCCCCCCCCCHHHH | 22.43 | 29967540 | |
212 | Ubiquitination | NQCSSTTHSKIFQYN CCCCCCCHHHHHCCC | 27.47 | 22817900 | |
214 | Ubiquitination | CSSTTHSKIFQYNKY CCCCCHHHHHCCCCC | 39.68 | 29967540 | |
215 | Ubiquitination | SSTTHSKIFQYNKYV CCCCHHHHHCCCCCE | 2.66 | 21890473 | |
219 | Ubiquitination | HSKIFQYNKYVKIFD HHHHHCCCCCEEEEC | 20.56 | 29967540 | |
220 | Ubiquitination | SKIFQYNKYVKIFDN HHHHCCCCCEEEECC | 46.62 | 22817900 | |
222 | Ubiquitination | IFQYNKYVKIFDNFS HHCCCCCEEEECCCC | 4.02 | 29967540 | |
223 | Ubiquitination | FQYNKYVKIFDNFSN HCCCCCEEEECCCCC | 34.27 | 22817900 | |
223 (in isoform 1) | Ubiquitination | - | 34.27 | 21890473 | |
224 | Ubiquitination | QYNKYVKIFDNFSNL CCCCCEEEECCCCCH | 3.60 | 22817900 | |
226 | Ubiquitination | NKYVKIFDNFSNLHR CCCEEEECCCCCHHH | 59.75 | 29967540 | |
227 | Ubiquitination | KYVKIFDNFSNLHRR CCEEEECCCCCHHHC | 31.34 | 21890473 | |
228 | Ubiquitination | YVKIFDNFSNLHRRN CEEEECCCCCHHHCC | 5.73 | 29967540 | |
229 | Ubiquitination | VKIFDNFSNLHRRNI EEEECCCCCHHHCCC | 44.74 | 29967540 | |
230 | Ubiquitination | KIFDNFSNLHRRNIS EEECCCCCHHHCCCC | 35.41 | 29967540 | |
230 (in isoform 7) | Ubiquitination | - | 35.41 | - | |
233 | Ubiquitination | DNFSNLHRRNISNTG CCCCCHHHCCCCCCC | 36.19 | 29967540 | |
235 | Ubiquitination | FSNLHRRNISNTGEK CCCHHHCCCCCCCCC | 41.83 | 22817900 | |
236 | Ubiquitination | SNLHRRNISNTGEKP CCHHHCCCCCCCCCC | 2.97 | 29967540 | |
238 | Ubiquitination | LHRRNISNTGEKPFK HHHCCCCCCCCCCEE | 48.59 | 21890473 | |
242 | Ubiquitination | NISNTGEKPFKCQEC CCCCCCCCCEECCCC | 58.04 | 29967540 | |
242 (in isoform 7) | Ubiquitination | - | 58.04 | - | |
245 | Ubiquitination | NTGEKPFKCQECGKS CCCCCCEECCCCCCH | 43.46 | 29967540 | |
249 | Ubiquitination | KPFKCQECGKSFQML CCEECCCCCCHHHHH | 3.25 | 29967540 | |
249 (in isoform 7) | Ubiquitination | - | 3.25 | - | |
250 | Ubiquitination | PFKCQECGKSFQMLS CEECCCCCCHHHHHH | 28.08 | 29967540 | |
253 | Ubiquitination | CQECGKSFQMLSFLT CCCCCCHHHHHHHHH | 5.88 | 29967540 | |
254 | Ubiquitination | QECGKSFQMLSFLTE CCCCCHHHHHHHHHH | 38.71 | 29967540 | |
256 | Ubiquitination | CGKSFQMLSFLTEHQ CCCHHHHHHHHHHHH | 1.97 | 29967540 | |
261 | Ubiquitination | QMLSFLTEHQKIHTG HHHHHHHHHHHHHCC | 46.60 | 29967540 | |
264 | Ubiquitination | SFLTEHQKIHTGKKF HHHHHHHHHHCCCCC | 38.06 | 29967540 | |
265 | Ubiquitination | FLTEHQKIHTGKKFQ HHHHHHHHHCCCCCC | 2.57 | 29967540 | |
272 | Ubiquitination | IHTGKKFQKCGECGK HHCCCCCCCCCCCCC | 49.35 | 29967540 | |
273 | Ubiquitination | HTGKKFQKCGECGKT HCCCCCCCCCCCCCE | 47.54 | 29967540 | |
275 | Ubiquitination | GKKFQKCGECGKTFI CCCCCCCCCCCCEEE | 40.02 | 29967540 | |
278 | Ubiquitination | FQKCGECGKTFIQCS CCCCCCCCCEEEECC | 27.95 | 29967540 | |
279 | Ubiquitination | QKCGECGKTFIQCSH CCCCCCCCEEEECCC | 52.50 | 29967540 | |
280 | Ubiquitination | KCGECGKTFIQCSHF CCCCCCCEEEECCCC | 15.97 | 29967540 | |
282 | Ubiquitination | GECGKTFIQCSHFTE CCCCCEEEECCCCCC | 4.96 | 29967540 | |
287 | Ubiquitination | TFIQCSHFTEPENID EEEECCCCCCCCCCC | 4.80 | 29967540 | |
291 | Ubiquitination | CSHFTEPENIDTGEK CCCCCCCCCCCCCCC | 61.66 | 29967540 | |
294 | Ubiquitination | FTEPENIDTGEKPYK CCCCCCCCCCCCCCC | 61.31 | 29967540 | |
298 | Ubiquitination | ENIDTGEKPYKCQEC CCCCCCCCCCCCHHC | 55.80 | 29967540 | |
301 | Ubiquitination | DTGEKPYKCQECNNV CCCCCCCCCHHCCCH | 37.66 | 29967540 | |
310 | Ubiquitination | QECNNVIKTCSVLTK HHCCCHHHHHHHHHC | 38.91 | 29967540 | |
311 | Ubiquitination | ECNNVIKTCSVLTKN HCCCHHHHHHHHHCC | 10.01 | 29967540 | |
315 | Ubiquitination | VIKTCSVLTKNRIYA HHHHHHHHHCCCCCC | 3.03 | 29967540 | |
315 (in isoform 7) | Ubiquitination | - | 3.03 | - | |
317 | Ubiquitination | KTCSVLTKNRIYAGG HHHHHHHCCCCCCCC | 39.82 | 29967540 | |
321 | Ubiquitination | VLTKNRIYAGGEHYR HHHCCCCCCCCCEEE | 8.92 | 29967540 | |
321 | Phosphorylation | VLTKNRIYAGGEHYR HHHCCCCCCCCCEEE | 8.92 | 29496907 | |
327 | Ubiquitination | IYAGGEHYRCEEFGK CCCCCCEEEHHHHHH | 16.80 | 29967540 | |
327 | Phosphorylation | IYAGGEHYRCEEFGK CCCCCCEEEHHHHHH | 16.80 | 29496907 | |
331 | Ubiquitination | GEHYRCEEFGKVFNQ CCEEEHHHHHHHHHH | 64.42 | 29967540 | |
336 | Ubiquitination | CEEFGKVFNQCSHLT HHHHHHHHHHCCCCC | 6.27 | 29967540 | |
336 | Acetylation | CEEFGKVFNQCSHLT HHHHHHHHHHCCCCC | 6.27 | 19608861 | |
338 | Ubiquitination | EFGKVFNQCSHLTEH HHHHHHHHCCCCCCC | 20.73 | 29967540 | |
339 | Ubiquitination | FGKVFNQCSHLTEHE HHHHHHHCCCCCCCC | 2.65 | 29967540 | |
340 | Ubiquitination | GKVFNQCSHLTEHEH HHHHHHCCCCCCCCC | 16.27 | 29967540 | |
340 (in isoform 7) | Ubiquitination | - | 16.27 | - | |
340 | Acetylation | GKVFNQCSHLTEHEH HHHHHHCCCCCCCCC | 16.27 | 19608861 | |
343 | Ubiquitination | FNQCSHLTEHEHGTE HHHCCCCCCCCCCCC | 29.85 | 29967540 | |
343 (in isoform 7) | Ubiquitination | - | 29.85 | - | |
344 | Ubiquitination | NQCSHLTEHEHGTEE HHCCCCCCCCCCCCC | 54.35 | 29967540 | |
346 | Ubiquitination | CSHLTEHEHGTEEKP CCCCCCCCCCCCCCC | 37.47 | 29967540 | |
348 | Ubiquitination | HLTEHEHGTEEKPCK CCCCCCCCCCCCCCC | 31.66 | 29967540 | |
352 | Ubiquitination | HEHGTEEKPCKYEEC CCCCCCCCCCCHHHC | 49.86 | 29967540 | |
354 | Ubiquitination | HGTEEKPCKYEECSS CCCCCCCCCHHHCCE | 12.42 | 29967540 | |
355 | Ubiquitination | GTEEKPCKYEECSSV CCCCCCCCHHHCCEE | 65.31 | 29967540 | |
359 | Ubiquitination | KPCKYEECSSVFISC CCCCHHHCCEEEEEC | 2.16 | 29967540 | |
359 (in isoform 7) | Ubiquitination | - | 2.16 | - | |
360 | Ubiquitination | PCKYEECSSVFISCS CCCHHHCCEEEEECH | 32.58 | 29967540 | |
362 | Ubiquitination | KYEECSSVFISCSSL CHHHCCEEEEECHHC | 2.58 | 29967540 | |
363 | Ubiquitination | YEECSSVFISCSSLS HHHCCEEEEECHHCC | 3.53 | 29967540 | |
363 | Acetylation | YEECSSVFISCSSLS HHHCCEEEEECHHCC | 3.53 | 19608861 | |
364 | Ubiquitination | EECSSVFISCSSLSN HHCCEEEEECHHCCC | 3.68 | 29967540 | |
366 | Ubiquitination | CSSVFISCSSLSNQQ CCEEEEECHHCCCCE | 2.47 | 29967540 | |
367 | Ubiquitination | SSVFISCSSLSNQQM CEEEEECHHCCCCEE | 27.76 | 29967540 | |
370 | Ubiquitination | FISCSSLSNQQMILA EEECHHCCCCEEECC | 34.24 | 29967540 | |
371 | Ubiquitination | ISCSSLSNQQMILAG EECHHCCCCEEECCC | 41.20 | 29967540 | |
371 | Acetylation | ISCSSLSNQQMILAG EECHHCCCCEEECCC | 41.20 | 19608861 | |
374 | Ubiquitination | SSLSNQQMILAGEKL HHCCCCEEECCCCCH | 1.63 | 29967540 | |
375 | Ubiquitination | SLSNQQMILAGEKLS HCCCCEEECCCCCHH | 1.75 | 29967540 | |
376 | Ubiquitination | LSNQQMILAGEKLSK CCCCEEECCCCCHHH | 4.15 | 29967540 | |
380 | Ubiquitination | QMILAGEKLSKCETW EEECCCCCHHHCCHH | 58.08 | 29967540 | |
382 | Ubiquitination | ILAGEKLSKCETWYK ECCCCCHHHCCHHHC | 46.45 | 29967540 | |
383 | Sumoylation | LAGEKLSKCETWYKG CCCCCHHHCCHHHCC | 46.67 | - | |
383 | Sumoylation | LAGEKLSKCETWYKG CCCCCHHHCCHHHCC | 46.67 | 25218447 | |
383 | Ubiquitination | LAGEKLSKCETWYKG CCCCCHHHCCHHHCC | 46.67 | 29967540 | |
385 | Ubiquitination | GEKLSKCETWYKGFN CCCHHHCCHHHCCCC | 46.22 | 29967540 | |
385 | Acetylation | GEKLSKCETWYKGFN CCCHHHCCHHHCCCC | 46.22 | 19608861 | |
388 | Ubiquitination | LSKCETWYKGFNHSP HHHCCHHHCCCCCCC | 14.51 | 29967540 | |
389 | Ubiquitination | SKCETWYKGFNHSPN HHCCHHHCCCCCCCC | 48.89 | 29967540 | |
389 | Acetylation | SKCETWYKGFNHSPN HHCCHHHCCCCCCCC | 48.89 | 19608861 | |
390 | Ubiquitination | KCETWYKGFNHSPNP HCCHHHCCCCCCCCC | 16.94 | 29967540 | |
392 | Ubiquitination | ETWYKGFNHSPNPSK CHHHCCCCCCCCCCH | 43.31 | 29967540 | |
394 | Phosphorylation | WYKGFNHSPNPSKHQ HHCCCCCCCCCCHHC | 27.72 | 25159151 | |
394 | Ubiquitination | WYKGFNHSPNPSKHQ HHCCCCCCCCCCHHC | 27.72 | 29967540 | |
396 (in isoform 7) | Ubiquitination | - | 57.39 | - | |
397 | Ubiquitination | GFNHSPNPSKHQRNE CCCCCCCCCHHCCCC | 48.41 | 29967540 | |
398 | Phosphorylation | FNHSPNPSKHQRNEI CCCCCCCCHHCCCCC | 49.78 | 27251275 | |
399 | Sumoylation | NHSPNPSKHQRNEIG CCCCCCCHHCCCCCC | 45.04 | - | |
399 | Sumoylation | NHSPNPSKHQRNEIG CCCCCCCHHCCCCCC | 45.04 | - | |
399 | Ubiquitination | NHSPNPSKHQRNEIG CCCCCCCHHCCCCCC | 45.04 | 29967540 | |
401 | Ubiquitination | SPNPSKHQRNEIGGK CCCCCHHCCCCCCCC | 54.34 | 29967540 | |
402 | Ubiquitination | PNPSKHQRNEIGGKP CCCCHHCCCCCCCCC | 42.33 | 29967540 | |
404 | Ubiquitination | PSKHQRNEIGGKPFK CCHHCCCCCCCCCCC | 45.24 | 29967540 | |
405 (in isoform 7) | Ubiquitination | - | 11.42 | - | |
408 | Acetylation | QRNEIGGKPFKCEEC CCCCCCCCCCCHHHC | 41.91 | 19608861 | |
408 | Ubiquitination | QRNEIGGKPFKCEEC CCCCCCCCCCCHHHC | 41.91 | 29967540 | |
411 | Ubiquitination | EIGGKPFKCEECDSI CCCCCCCCHHHCHHH | 49.62 | 29967540 | |
413 | Ubiquitination | GGKPFKCEECDSIFK CCCCCCHHHCHHHHH | 63.35 | 29967540 | |
416 | Ubiquitination | PFKCEECDSIFKWFS CCCHHHCHHHHHHHH | 48.31 | 29967540 | |
417 | Ubiquitination | FKCEECDSIFKWFSD CCHHHCHHHHHHHHH | 41.40 | 29967540 | |
417 | Phosphorylation | FKCEECDSIFKWFSD CCHHHCHHHHHHHHH | 41.40 | 24719451 | |
420 | Ubiquitination | EECDSIFKWFSDLTK HHCHHHHHHHHHHHC | 45.73 | 29967540 | |
427 | Ubiquitination | KWFSDLTKHKRIHTG HHHHHHHCCCCCCCC | 55.19 | 29967540 | |
432 | Ubiquitination | LTKHKRIHTGEKPYK HHCCCCCCCCCCCCC | 31.67 | 29967540 | |
433 | Phosphorylation | TKHKRIHTGEKPYKC HCCCCCCCCCCCCCC | 44.67 | 29496963 | |
436 | Ubiquitination | KRIHTGEKPYKCDEC CCCCCCCCCCCCCCC | 55.80 | 29967540 | |
439 | Ubiquitination | HTGEKPYKCDECGKA CCCCCCCCCCCCCCC | 43.68 | 29967540 | |
440 | Ubiquitination | TGEKPYKCDECGKAY CCCCCCCCCCCCCCC | 4.37 | 29967540 | |
447 | Phosphorylation | CDECGKAYTQSSHLS CCCCCCCCCCCCCHH | 14.59 | 29496907 | |
448 | Ubiquitination | DECGKAYTQSSHLSE CCCCCCCCCCCCHHC | 27.17 | 29967540 | |
452 | Ubiquitination | KAYTQSSHLSEHRRI CCCCCCCCHHCCCCC | 38.32 | 29967540 | |
457 | Ubiquitination | SSHLSEHRRIHTGEK CCCHHCCCCCCCCCC | 34.89 | 29967540 | |
459 | Ubiquitination | HLSEHRRIHTGEKPY CHHCCCCCCCCCCCC | 3.25 | 29967540 | |
461 | Phosphorylation | SEHRRIHTGEKPYQC HCCCCCCCCCCCCCH | 44.67 | 28111955 | |
461 | Ubiquitination | SEHRRIHTGEKPYQC HCCCCCCCCCCCCCH | 44.67 | 29967540 | |
462 | Ubiquitination | EHRRIHTGEKPYQCE CCCCCCCCCCCCCHH | 27.11 | 29967540 | |
464 | Ubiquitination | RRIHTGEKPYQCEEC CCCCCCCCCCCHHHH | 50.82 | - | |
466 | Ubiquitination | IHTGEKPYQCEECGK CCCCCCCCCHHHHHH | 36.54 | 29967540 | |
467 | Ubiquitination | HTGEKPYQCEECGKV CCCCCCCCHHHHHHH | 36.35 | 29967540 | |
469 | Ubiquitination | GEKPYQCEECGKVFR CCCCCCHHHHHHHHH | 40.57 | 29967540 | |
473 | Ubiquitination | YQCEECGKVFRTCSS CCHHHHHHHHHHHHH | 50.27 | 29967540 | |
475 | Ubiquitination | CEECGKVFRTCSSLS HHHHHHHHHHHHHHH | 6.45 | 29967540 | |
481 | Ubiquitination | VFRTCSSLSNHKRTH HHHHHHHHHCCCCCC | 3.23 | 29967540 | |
483 | Ubiquitination | RTCSSLSNHKRTHSE HHHHHHHCCCCCCCC | 50.41 | 29967540 | |
484 | Ubiquitination | TCSSLSNHKRTHSEE HHHHHHCCCCCCCCC | 20.00 | 29967540 | |
485 | Ubiquitination | CSSLSNHKRTHSEEK HHHHHCCCCCCCCCC | 64.34 | 29967540 | |
489 | Phosphorylation | SNHKRTHSEEKPYTC HCCCCCCCCCCCCCH | 47.00 | 21712546 | |
492 | Sumoylation | KRTHSEEKPYTCEEC CCCCCCCCCCCHHHH | 38.99 | - | |
492 | Sumoylation | KRTHSEEKPYTCEEC CCCCCCCCCCCHHHH | 38.99 | 28112733 | |
492 | Ubiquitination | KRTHSEEKPYTCEEC CCCCCCCCCCCHHHH | 38.99 | 29967540 | |
495 | Phosphorylation | HSEEKPYTCEECGNI CCCCCCCCHHHHHHH | 23.20 | 28555341 | |
496 | Ubiquitination | SEEKPYTCEECGNIF CCCCCCCHHHHHHHH | 3.23 | 29967540 | |
497 | Ubiquitination | EEKPYTCEECGNIFK CCCCCCHHHHHHHHH | 48.82 | 29967540 | |
501 | Ubiquitination | YTCEECGNIFKQLSD CCHHHHHHHHHHHHH | 48.45 | 29967540 | |
504 | Ubiquitination | EECGNIFKQLSDLTK HHHHHHHHHHHHHHH | 46.67 | 29967540 | |
506 | Ubiquitination | CGNIFKQLSDLTKHK HHHHHHHHHHHHHCC | 4.42 | 29967540 | |
510 | Ubiquitination | FKQLSDLTKHKKTHT HHHHHHHHHCCCCCC | 35.77 | 29967540 | |
513 | Ubiquitination | LSDLTKHKKTHTGEK HHHHHHCCCCCCCCC | 62.01 | 29967540 | |
514 | Ubiquitination | SDLTKHKKTHTGEKP HHHHHCCCCCCCCCC | 45.30 | - | |
515 | Phosphorylation | DLTKHKKTHTGEKPY HHHHCCCCCCCCCCC | 29.49 | 28348404 | |
517 | Phosphorylation | TKHKKTHTGEKPYKC HHCCCCCCCCCCCCC | 52.87 | 24719451 | |
517 | Ubiquitination | TKHKKTHTGEKPYKC HHCCCCCCCCCCCCC | 52.87 | 29967540 | |
518 | Ubiquitination | KHKKTHTGEKPYKCD HCCCCCCCCCCCCCC | 33.07 | 29967540 | |
520 | Ubiquitination | KKTHTGEKPYKCDEC CCCCCCCCCCCCCCC | 55.80 | 29967540 | |
522 | Ubiquitination | THTGEKPYKCDECGK CCCCCCCCCCCCCCC | 35.00 | 29967540 | |
529 | Ubiquitination | YKCDECGKNFTQSSN CCCCCCCCCCCCCCC | 61.62 | 29967540 | |
535 | Phosphorylation | GKNFTQSSNLIVHKR CCCCCCCCCEEEEEE | 26.32 | 28555341 | |
540 | Ubiquitination | QSSNLIVHKRIHTGE CCCCEEEEEEECCCC | 13.49 | 29967540 | |
541 | Acetylation | SSNLIVHKRIHTGEK CCCEEEEEEECCCCC | 42.00 | 30593613 | |
541 | Sumoylation | SSNLIVHKRIHTGEK CCCEEEEEEECCCCC | 42.00 | - | |
541 | Sumoylation | SSNLIVHKRIHTGEK CCCEEEEEEECCCCC | 42.00 | - | |
541 | Ubiquitination | SSNLIVHKRIHTGEK CCCEEEEEEECCCCC | 42.00 | 29967540 | |
545 | Phosphorylation | IVHKRIHTGEKPYKC EEEEEECCCCCCEEC | 44.67 | 29496963 | |
548 | Ubiquitination | KRIHTGEKPYKCEEC EEECCCCCCEECCCC | 55.80 | 29967540 | |
562 | Ubiquitination | CGRVFMWFSDITKHK CCCEEEEEHHCCCCC | 2.94 | 29967540 | |
566 | Ubiquitination | FMWFSDITKHKKTHT EEEEHHCCCCCCCCC | 31.89 | 29967540 | |
570 | Ubiquitination | SDITKHKKTHTGEKP HHCCCCCCCCCCCCC | 45.30 | - | |
571 | Phosphorylation | DITKHKKTHTGEKPY HCCCCCCCCCCCCCE | 29.49 | 28348404 | |
573 | Phosphorylation | TKHKKTHTGEKPYKC CCCCCCCCCCCCEEC | 52.87 | 24719451 | |
576 | Ubiquitination | KKTHTGEKPYKCDEC CCCCCCCCCEECCCC | 55.80 | - | |
585 | Ubiquitination | YKCDECGKNFTQSSN EECCCCCCCCCCCCC | 61.62 | 29967540 | |
591 | Phosphorylation | GKNFTQSSNLIVHKR CCCCCCCCCEEEEEE | 26.32 | 28555341 | |
597 | Acetylation | SSNLIVHKRIHTGEK CCCEEEEEEEECCCC | 42.00 | 30593617 | |
597 | Sumoylation | SSNLIVHKRIHTGEK CCCEEEEEEEECCCC | 42.00 | - | |
597 | Sumoylation | SSNLIVHKRIHTGEK CCCEEEEEEEECCCC | 42.00 | - | |
597 | Ubiquitination | SSNLIVHKRIHTGEK CCCEEEEEEEECCCC | 42.00 | - | |
601 | Phosphorylation | IVHKRIHTGEKPYKC EEEEEEECCCCCEEC | 44.67 | 29496963 | |
606 | Phosphorylation | IHTGEKPYKCEKCGK EECCCCCEECCCCCC | 39.06 | - | |
629 | Phosphorylation | TVHESIHT------- EECCCCCC------- | 38.34 | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN195_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN195_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN195_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZN195_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-408, AND MASS SPECTROMETRY. |