| UniProt ID | ZG16_HUMAN | |
|---|---|---|
| UniProt AC | O60844 | |
| Protein Name | Zymogen granule membrane protein 16 | |
| Gene Name | ZG16 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 167 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix . Cytoplasmic vesicle lumen . Golgi apparatus lumen . Stored in zymogen granules.. | |
| Protein Description | May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.. | |
| Protein Sequence | MLTVALLALLCASASGNAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPSSCSRC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | GNAIQARSSSYSGEY CCCHHHCCCCCCCCC | 27.01 | 29759185 | |
| 24 | Phosphorylation | NAIQARSSSYSGEYG CCHHHCCCCCCCCCC | 27.95 | 29759185 | |
| 25 | Phosphorylation | AIQARSSSYSGEYGG CHHHCCCCCCCCCCC | 25.27 | - | |
| 30 | Phosphorylation | SSSYSGEYGGGGGKR CCCCCCCCCCCCCCC | 21.81 | - | |
| 39 | Phosphorylation | GGGGKRFSHSGNQLD CCCCCCCCCCCCCCC | 22.30 | 23312004 | |
| 41 | Phosphorylation | GGKRFSHSGNQLDGP CCCCCCCCCCCCCCC | 37.94 | 23312004 | |
| 50 | Phosphorylation | NQLDGPITALRVRVN CCCCCCEEEEEEEEC | 23.83 | 24719451 | |
| 143 | Phosphorylation | NTVLRFISGRSGSLI CCEEEEEECCCCCCC | 25.99 | 24719451 | |
| 146 | Phosphorylation | LRFISGRSGSLIDAI EEEEECCCCCCCHHE | 35.94 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZG16_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZG16_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZG16_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZG16_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...