| UniProt ID | ZFPL1_MOUSE | |
|---|---|---|
| UniProt AC | Q9DB43 | |
| Protein Name | Zinc finger protein-like 1 | |
| Gene Name | Zfpl1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 310 | |
| Subcellular Localization |
Golgi apparatus, cis-Golgi network membrane Single-pass membrane protein. |
|
| Protein Description | Required for cis-Golgi integrity and efficient ER to Golgi transport. Involved in the maintenance of the integrity of the cis-Golgi, possibly via its interaction with GOLGA2/GM130 (By similarity).. | |
| Protein Sequence | MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNTPLASRETTRLVCYDLFHWACINERAAQLPRNTAPAGYQCPSCNGPIFPPANLAGPVASALREKLATVNWARAGLGLPLIDEVISPEPEPLNSSDFSDWSSFNATTTSVQEERASTPSAPAFYSQAPRPPPSPSRPEQHTVIHMGSTEALAHAPRKVYDTRDDDRTAGIHGDCDDDKYRRRPALGWLAQLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 172 | Phosphorylation | SVQEERASTPSAPAF CHHHHHCCCCCCCCH | 47.26 | 25159016 | |
| 173 | Phosphorylation | VQEERASTPSAPAFY HHHHHCCCCCCCCHH | 21.93 | 25159016 | |
| 175 | Phosphorylation | EERASTPSAPAFYSQ HHHCCCCCCCCHHCC | 47.15 | 25159016 | |
| 180 | Phosphorylation | TPSAPAFYSQAPRPP CCCCCCHHCCCCCCC | 11.28 | 25159016 | |
| 181 | Phosphorylation | PSAPAFYSQAPRPPP CCCCCHHCCCCCCCC | 17.26 | 25159016 | |
| 189 | Phosphorylation | QAPRPPPSPSRPEQH CCCCCCCCCCCCCCC | 41.08 | 26824392 | |
| 191 | Phosphorylation | PRPPPSPSRPEQHTV CCCCCCCCCCCCCEE | 65.88 | 25159016 | |
| 197 | Phosphorylation | PSRPEQHTVIHMGST CCCCCCCEEEECCCH | 22.35 | 25159016 | |
| 203 | Phosphorylation | HTVIHMGSTEALAHA CEEEECCCHHHHHCC | 18.59 | 25159016 | |
| 204 | Phosphorylation | TVIHMGSTEALAHAP EEEECCCHHHHHCCC | 21.39 | 25159016 | |
| 230 | S-nitrosocysteine | TAGIHGDCDDDKYRR CCCCCCCCCCHHHHH | 7.96 | - | |
| 230 | S-nitrosylation | TAGIHGDCDDDKYRR CCCCCCCCCCHHHHH | 7.96 | 21278135 | |
| 234 | Acetylation | HGDCDDDKYRRRPAL CCCCCCHHHHHCHHH | 47.88 | 22826441 | |
| 235 | Phosphorylation | GDCDDDKYRRRPALG CCCCCHHHHHCHHHH | 19.15 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZFPL1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZFPL1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZFPL1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZFPL1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
