UniProt ID | ZFN2A_HUMAN | |
---|---|---|
UniProt AC | Q8N6M9 | |
Protein Name | AN1-type zinc finger protein 2A | |
Gene Name | ZFAND2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 145 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | ||
Protein Sequence | MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Ubiquitination | LGKHCSEKTCKQLDF HHHHCCHHHHHHCCC | 42.82 | 27667366 | |
16 | Ubiquitination | HCSEKTCKQLDFLPV HCCHHHHHHCCCCEE | 60.16 | 29967540 | |
29 | Ubiquitination | PVKCDACKQDFCKDH EECCCHHCCHHHHHC | 55.40 | 27667366 | |
34 | Ubiquitination | ACKQDFCKDHFPYAA HHCCHHHHHCCCCHH | 54.99 | 21906983 | |
43 | Ubiquitination | HFPYAAHKCPFAFQK CCCCHHHCCCCCCCC | 38.59 | 29967540 | |
50 | Ubiquitination | KCPFAFQKDVHVPVC CCCCCCCCCCCCCCC | 56.09 | 29967540 | |
62 | Phosphorylation | PVCPLCNTPIPVKKG CCCCCCCCCCCCCCC | 22.92 | 25159151 | |
67 | Ubiquitination | CNTPIPVKKGQIPDV CCCCCCCCCCCCCCE | 45.92 | 21906983 | |
68 | Ubiquitination | NTPIPVKKGQIPDVV CCCCCCCCCCCCCEE | 57.17 | 29967540 | |
90 | Ubiquitination | DCDSHPGKKKEKIFT CCCCCCCCCHHHEEE | 66.19 | 27667366 | |
91 | Ubiquitination | CDSHPGKKKEKIFTY CCCCCCCCHHHEEEE | 72.57 | 29967540 | |
94 | Ubiquitination | HPGKKKEKIFTYRCS CCCCCHHHEEEEECC | 52.58 | 27667366 | |
97 | Phosphorylation | KKKEKIFTYRCSKEG CCHHHEEEEECCCCC | 17.33 | 26699800 | |
98 | Phosphorylation | KKEKIFTYRCSKEGC CHHHEEEEECCCCCC | 10.00 | 26699800 | |
101 | Phosphorylation | KIFTYRCSKEGCKKK HEEEEECCCCCCCHH | 25.41 | 26699800 | |
102 | Ubiquitination | IFTYRCSKEGCKKKE EEEEECCCCCCCHHH | 62.85 | 29967540 | |
143 | Ubiquitination | HGSRPTIKAG----- CCCCCCCCCC----- | 49.92 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZFN2A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZFN2A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZFN2A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZFN2A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...