UniProt ID | ZDHC9_HUMAN | |
---|---|---|
UniProt AC | Q9Y397 | |
Protein Name | Palmitoyltransferase ZDHHC9 | |
Gene Name | ZDHHC9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 364 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.. | |
Protein Sequence | MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Phosphorylation | AAMLFLFSMATLLRT HHHHHHHHHHHHHHH | 15.06 | - | |
82 | Phosphorylation | LFLFSMATLLRTSFS HHHHHHHHHHHHHCC | 20.06 | - | |
127 | Ubiquitination | QRPPPRIKNFQINNQ CCCCCCCEEEEECCE | 53.65 | 22817900 | |
137 | Ubiquitination | QINNQIVKLKYCYTC EECCEEEEEEECEEC | 40.67 | 29901268 | |
139 | Ubiquitination | NNQIVKLKYCYTCKI CCEEEEEEECEECCC | 27.79 | 29901268 | |
267 | Ubiquitination | IKGSWTGKNRVQNPY CCCCCCCCCCCCCCC | 33.92 | 29967540 | |
281 | Ubiquitination | YSHGNIVKNCCEVLC CCCCCHHHCHHHHHH | 40.23 | 21963094 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZDHC9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZDHC9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZDHC9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZDHC9_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00658 | Syndromic X-linked mental retardation, including: Turner type (MRXST); Siderius type (MRXSSD) ; Cabe | |||||
OMIM Disease | ||||||
300799 | Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...