| UniProt ID | ZDH20_HUMAN | |
|---|---|---|
| UniProt AC | Q5W0Z9 | |
| Protein Name | Palmitoyltransferase ZDHHC20 | |
| Gene Name | ZDHHC20 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 365 | |
| Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . Cell membrane Multi-pass membrane protein . Cytoplasm, perinuclear region . |
|
| Protein Description | Catalyzes palmitoylation of Cys residues on target proteins. [PubMed: 27153536] | |
| Protein Sequence | MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Ubiquitination | FYLSNSEKERYEKEF EECCHHHHHHHHHHH | 47.51 | 21906983 | |
| 91 (in isoform 2) | Ubiquitination | - | 47.51 | 21890473 | |
| 91 (in isoform 1) | Ubiquitination | - | 47.51 | 21890473 | |
| 96 | Ubiquitination | SEKERYEKEFSQERQ HHHHHHHHHHCHHHH | 55.94 | 21890473 | |
| 96 (in isoform 2) | Ubiquitination | - | 55.94 | 21890473 | |
| 96 (in isoform 1) | Ubiquitination | - | 55.94 | 21890473 | |
| 96 | Ubiquitination | SEKERYEKEFSQERQ HHHHHHHHHHCHHHH | 55.94 | 21890473 | |
| 96 | Ubiquitination | SEKERYEKEFSQERQ HHHHHHHHHHCHHHH | 55.94 | 21890473 | |
| 117 | Phosphorylation | AARALPIYTTSASKT HHHHCCEEECCCCHH | 11.30 | 27642862 | |
| 123 | Ubiquitination | IYTTSASKTIRYCEK EEECCCCHHHHHHCC | 47.92 | - | |
| 124 | Phosphorylation | YTTSASKTIRYCEKC EECCCCHHHHHHCCC | 14.27 | - | |
| 130 | Ubiquitination | KTIRYCEKCQLIKPD HHHHHHCCCCEECCC | 24.58 | - | |
| 265 | Ubiquitination | GFSLGCSKNWRQVFG CEECCCCCCHHHHHC | 65.68 | - | |
| 305 (in isoform 3) | Phosphorylation | - | 29.21 | 25849741 | |
| 305 | Phosphorylation | GMDPEQASVTNQNEY CCCHHHCCCCCHHHH | 29.21 | 22617229 | |
| 307 | Phosphorylation | DPEQASVTNQNEYAR CHHHCCCCCHHHHHH | 28.70 | 21945579 | |
| 312 | Phosphorylation | SVTNQNEYARSSGSN CCCCHHHHHHCCCCC | 18.18 | 21945579 | |
| 315 (in isoform 3) | Phosphorylation | - | 30.77 | 24719451 | |
| 315 | Phosphorylation | NQNEYARSSGSNQPF CHHHHHHCCCCCCCC | 30.77 | 22617229 | |
| 316 | Phosphorylation | QNEYARSSGSNQPFP HHHHHHCCCCCCCCC | 40.46 | 28787133 | |
| 318 | Phosphorylation | EYARSSGSNQPFPIK HHHHCCCCCCCCCCC | 33.95 | 22617229 | |
| 324 | Ubiquitination | GSNQPFPIKPLSESK CCCCCCCCCCCCHHH | 8.00 | - | |
| 325 (in isoform 1) | Ubiquitination | - | 39.89 | 21890473 | |
| 325 | Ubiquitination | SNQPFPIKPLSESKN CCCCCCCCCCCHHHC | 39.89 | 2190698 | |
| 327 | Phosphorylation | QPFPIKPLSESKNRL CCCCCCCCCHHHCCC | 8.24 | - | |
| 327 (in isoform 3) | Phosphorylation | - | 8.24 | 24719451 | |
| 328 | Phosphorylation | PFPIKPLSESKNRLL CCCCCCCCHHHCCCC | 48.64 | 23401153 | |
| 329 | Phosphorylation | FPIKPLSESKNRLLD CCCCCCCHHHCCCCC | 73.70 | - | |
| 329 (in isoform 3) | Phosphorylation | - | 73.70 | 30131370 | |
| 330 | Ubiquitination | PIKPLSESKNRLLDS CCCCCCHHHCCCCCC | 31.67 | - | |
| 330 (in isoform 3) | Ubiquitination | - | 31.67 | - | |
| 330 | Phosphorylation | PIKPLSESKNRLLDS CCCCCCHHHCCCCCC | 31.67 | 23911959 | |
| 337 | Phosphorylation | SKNRLLDSESQWLEN HHCCCCCCHHHHHHC | 38.83 | 29514088 | |
| 338 | Phosphorylation | KNRLLDSESQWLENG HCCCCCCHHHHHHCC | 46.76 | 17525332 | |
| 339 | Phosphorylation | NRLLDSESQWLENGA CCCCCCHHHHHHCCC | 30.52 | 17525332 | |
| 351 (in isoform 3) | Ubiquitination | - | 6.24 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZDH20_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZDH20_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZDH20_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZDH20_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage."; Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.; Science 316:1160-1166(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-339, AND MASSSPECTROMETRY. | |
