UniProt ID | ZDH15_HUMAN | |
---|---|---|
UniProt AC | Q96MV8 | |
Protein Name | Palmitoyltransferase ZDHHC15 | |
Gene Name | ZDHHC15 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 337 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes palmitoylation of Cys residues on target proteins. Catalyzes palmitoylation of GAP43 and DLG4/PSD95.. | |
Protein Sequence | MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
97 | Phosphorylation | SYTDKERYENEERPE CCCCHHHHCCCCCHH | 24.97 | - | |
107 | Acetylation | EERPEVQKQMLVDMA CCCHHHHHHHHHHHH | 42.73 | 18523073 | |
130 | Phosphorylation | TGSGAVRFCDRCHLI CCCCCCCCCCCCCCC | 4.00 | 27251275 | |
130 (in isoform 2) | Phosphorylation | - | 4.00 | 27251275 | |
132 | Phosphorylation | SGAVRFCDRCHLIKP CCCCCCCCCCCCCCC | 54.23 | 27251275 | |
132 (in isoform 2) | Phosphorylation | - | 54.23 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZDH15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZDH15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZDH15_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZDH15_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...