ZDH12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZDH12_HUMAN
• UniProt AC: Q96GR4
• Protein Name: Probable palmitoyltransferase ZDHHC12
• Gene Name: ZDHHC12
• Organism: Homo sapiens (Human).
• Sequence Length: 267
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGQWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	SPGVLVRTGHTVLTW CCCEEEECCCHHHHH	26.32	24043423
18	Phosphorylation	VLVRTGHTVLTWGIT EEEECCCHHHHHCEE	20.68	24043423
21	Phosphorylation	RTGHTVLTWGITLVL ECCCHHHHHCEEEEE	19.80	24043423
25	Phosphorylation	TVLTWGITLVLFLHD HHHHHCEEEEEEHHH	13.58	24043423
33	Phosphorylation	LVLFLHDTELRQWEE EEEEHHHHHHHHHHH	26.60	24043423
87	Phosphorylation	EELKEEQTAMVPPAI HHHHHHHHCCCCCCC	21.72	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZDH12_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZDH12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZDH12_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ZDH12_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.