UniProt ID | ZDH12_HUMAN | |
---|---|---|
UniProt AC | Q96GR4 | |
Protein Name | Probable palmitoyltransferase ZDHHC12 | |
Gene Name | ZDHHC12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 267 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGQWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | SPGVLVRTGHTVLTW CCCEEEECCCHHHHH | 26.32 | 24043423 | |
18 | Phosphorylation | VLVRTGHTVLTWGIT EEEECCCHHHHHCEE | 20.68 | 24043423 | |
21 | Phosphorylation | RTGHTVLTWGITLVL ECCCHHHHHCEEEEE | 19.80 | 24043423 | |
25 | Phosphorylation | TVLTWGITLVLFLHD HHHHHCEEEEEEHHH | 13.58 | 24043423 | |
33 | Phosphorylation | LVLFLHDTELRQWEE EEEEHHHHHHHHHHH | 26.60 | 24043423 | |
87 | Phosphorylation | EELKEEQTAMVPPAI HHHHHHHHCCCCCCC | 21.72 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZDH12_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZDH12_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZDH12_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZDH12_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...