dbPTM

ZDH11_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ZDH11_ARATH
UniProt AC	Q7XA86
Protein Name	Protein S-acyltransferase 10
Gene Name	PAT10
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	340
Subcellular Localization	Vacuole membrane Multi-pass membrane protein . Transient expression results in mistargeting of PAT10 to the Golgi apparatus, while the non-functional mutant is also localized in Golgi apparatus membranes.
Protein Description	S-acyltransferase involved in protein lipid modification. Catalyzes the palmitoylation of proteins peripheral or integral to the tonoplast. Required for the tonoplast localization of CBL2, CBL3 and CBL6, but not for the plasma membrane localization of CBL9, for the endosome localization of RABF1 or for the endomembrane localization of RABF2B..
Protein Sequence	MGVCCPFLQPWDRARDQCLLNLPCLSDPVRRSSLLLKLALVALHLVFIGFLFLFDAEFIEKTKRDPWYMGCYILLFSATLLQYFVTSGSSPGYVVDAMRDVCEASAMYRNPSTTSIQHASRKSESVVVNVEGGSASCPRRPPTPWGKLVLDLYPPGTSIRNLTCGYCHVEQPPRTKHCHDCDRCVLQFDHHCVWLGTCIGQKNHSKFWWYICEETTLCIWTLIMYVDYLSNVAKPWWKNAIIILLLVILAISLIFVLLLLIFHSYLILTNQSTYELVRRRRIPYMRNIPGRVHPFSRGIRRNLYNVCCGNYNLDSLPTAFELEDRSRPYTCIDMLKCRCC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
112	Phosphorylation	SAMYRNPSTTSIQHA HHHHCCCCCCCCCCC	48.11	25561503
136	Phosphorylation	NVEGGSASCPRRPPT EEECCCCCCCCCCCC	26.76	24243849
143	Phosphorylation	SCPRRPPTPWGKLVL CCCCCCCCCCCCEEE	34.06	24243849
192	S-palmitoylation	VLQFDHHCVWLGTCI EEEECCEEEEECEEE	1.79	23795888

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ZDH11_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ZDH11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ZDH11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ZDH11_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ZDH11_ARATH

Related Literatures of Post-Translational Modification