ZCHC9_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZCHC9_MOUSE
• UniProt AC: Q8R1J3
• Protein Name: Zinc finger CCHC domain-containing protein 9
• Gene Name: Zcchc9
• Organism: Mus musculus (Mouse).
• Sequence Length: 271
• Subcellular Localization: Nucleus, nucleolus . Nucleus . Expressed throughout the nucleus and concentrated mainly in the nucleolus.
• Protein Description: May down-regulate transcription mediated by NF-kappa-B and the serum response element..
• Protein Sequence: MTRWARVTTSNSKRPLSATSWEDMKKGSVERADQSLPNRKQCQSSRLPLRNDSPQAKRKKNKKKKEYLNEDVNGFMEYLKQNSQVLHNGQLIAADSQEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGICYRCGSTEHEMSKCRANVDPALGEFPFAKCFVCGEMGHLSRSCPDNTKGVYADGGSCKLCGSVEHFKKDCRENQNSDRIITVGRWAKGMSADYEDVLDVPKLQKPKTKVPKVVNF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	RLPLRNDSPQAKRKK CCCCCCCCHHHHHHH	23.59	26824392
246	Phosphorylation	GRWAKGMSADYEDVL HHHHHCCCCCHHHHC	27.02	25159016
249	Phosphorylation	AKGMSADYEDVLDVP HHCCCCCHHHHCCCC	17.47	25159016

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZCHC9_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZCHC9_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZCHC9_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ZCHC9_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.