UniProt ID | ZCHC9_MOUSE | |
---|---|---|
UniProt AC | Q8R1J3 | |
Protein Name | Zinc finger CCHC domain-containing protein 9 | |
Gene Name | Zcchc9 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 271 | |
Subcellular Localization | Nucleus, nucleolus . Nucleus . Expressed throughout the nucleus and concentrated mainly in the nucleolus. | |
Protein Description | May down-regulate transcription mediated by NF-kappa-B and the serum response element.. | |
Protein Sequence | MTRWARVTTSNSKRPLSATSWEDMKKGSVERADQSLPNRKQCQSSRLPLRNDSPQAKRKKNKKKKEYLNEDVNGFMEYLKQNSQVLHNGQLIAADSQEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGICYRCGSTEHEMSKCRANVDPALGEFPFAKCFVCGEMGHLSRSCPDNTKGVYADGGSCKLCGSVEHFKKDCRENQNSDRIITVGRWAKGMSADYEDVLDVPKLQKPKTKVPKVVNF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | Phosphorylation | RLPLRNDSPQAKRKK CCCCCCCCHHHHHHH | 23.59 | 26824392 | |
246 | Phosphorylation | GRWAKGMSADYEDVL HHHHHCCCCCHHHHC | 27.02 | 25159016 | |
249 | Phosphorylation | AKGMSADYEDVLDVP HHCCCCCHHHHCCCC | 17.47 | 25159016 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZCHC9_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZCHC9_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZCHC9_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZCHC9_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...