dbPTM

ZC12D_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ZC12D_MOUSE
UniProt AC	Q8BIY3
Protein Name	Probable ribonuclease ZC3H12D
Gene Name	Zc3h12d {ECO:0000312\|MGI:MGI:3045313}
Organism	Mus musculus (Mouse).
Sequence Length	533
Subcellular Localization	Cytoplasm . Cytoplasm, P-body . Colocalizes with ZC3H12A in GW bodies (GWBs).
Protein Description	May regulate cell growth likely by suppressing RB1 phosphorylation (By similarity). May function as RNase and regulate the levels of target RNA species (Potential). In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA level in activated macrophages. [PubMed: 26134560 Serve as a tumor suppressor in certain leukemia cells (By similarity Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation (By similarity]
Protein Sequence	MEHRSKMEFFQKLGYSQEDVVRVLGKLGDSALVNDVLQELIQTGSRPRAQEDPASGTGVVLIPRGCCGVQDSAQQGPGTRPRRGWRRSSPLLRPIVIDGSNVAMSHGNKEAFSCRGIRLAVDWFTDRGHTYIKVFVPSWRKEPSRSDTPIREQHVLEELERQAVLVYTPSRKVNGKRVVCYDDRYIVKVAYEKDGIIVSNDNYRDLQNENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRRGPTLSNFLSKKPRPPEPSWQHCPYGKKCTYGVKCRFYHPERPHHGQLSVADELRAKTRAWLGGGAEEPRTPSARSRPTTARLLPQEPGEHDLPPAPQPAVLAALNRSFARLTFSDTAASGVVSQSRGPDWMPTGVPTSWAPPSLRAGSAATIGLPGMRSLRTPNNPLSPGDLGSPICPQARLSERHRSRDMHSDLPPQRRPLEDPWALLPSSYCYLNHSVWSESAWGEDIFRGPSESAQPVANGGGTRPVHCSFFPPDQDHPVMASGPPLSDMALLTLLQRSQKTGAPLGDP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
88	Phosphorylation	PRRGWRRSSPLLRPI CCCCCCCCCCCCCCE	27.95	22324799
89	Phosphorylation	RRGWRRSSPLLRPIV CCCCCCCCCCCCCEE	20.11	22942356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ZC12D_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ZC12D_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ZC12D_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ZC12D_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ZC12D_MOUSE

Related Literatures of Post-Translational Modification