UniProt ID | YTHD2_MOUSE | |
---|---|---|
UniProt AC | Q91YT7 | |
Protein Name | YTH domain-containing family protein 2 {ECO:0000305} | |
Gene Name | Ythdf2 {ECO:0000312|MGI:MGI:2444233} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 579 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus . Cytoplasm, P-body . Localizes to the cytosol and relocates to the nucleus following heat shock stress. | |
Protein Description | Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. [PubMed: 28867294 M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in mRNA stability and processing] | |
Protein Sequence | MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASSVPKVVGSAVGSGSITSNIVASSSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSASSLLEQ ------CCHHHHHHH | 26824392 | ||
2 | Acetylation | ------MSASSLLEQ ------CCHHHHHHH | - | ||
4 | Phosphorylation | ----MSASSLLEQRP ----CCHHHHHHHCC | 29233185 | ||
5 | Phosphorylation | ---MSASSLLEQRPK ---CCHHHHHHHCCC | 30352176 | ||
22 | Phosphorylation | GNKVQNGSVHQKDGL CCCCCCCCCCCCCCC | - | ||
37 | Phosphorylation | NDDDFEPYLSPQARP CCCCCCCCCCCCCCC | 18563927 | ||
39 | Phosphorylation | DDFEPYLSPQARPNN CCCCCCCCCCCCCCC | 26824392 | ||
196 | Phosphorylation | MAALKLGSTEVASSV HHHHHCCCCHHHHCC | 26060331 | ||
201 | Phosphorylation | LGSTEVASSVPKVVG CCCCHHHHCCCEECC | 28066266 | ||
202 | Phosphorylation | GSTEVASSVPKVVGS CCCHHHHCCCEECCC | 26824392 | ||
277 | Phosphorylation | KHNMDIGTWDNKGPV CCCCCCCCCCCCCCC | 18846507 | ||
300 | Phosphorylation | VQNIGQPTQGSPQPV HHHCCCCCCCCCCCC | 23140645 | ||
303 | Phosphorylation | IGQPTQGSPQPVGQQ CCCCCCCCCCCCCCC | 23140645 | ||
314 | Phosphorylation | VGQQANNSPPVAQAS CCCCCCCCCCCCCCC | 23140645 | ||
321 | Phosphorylation | SPPVAQASVGQQTQP CCCCCCCCCCCCCCC | 23140645 | ||
326 | Phosphorylation | QASVGQQTQPLPPPP CCCCCCCCCCCCCCC | 23140645 | ||
340 | Phosphorylation | PPQPAQLSVQQQAAQ CCCCCCCCHHHHHCC | 23140645 | ||
359 | Phosphorylation | VAPRNRGSGFGHNGV ECCCCCCCCCCCCCC | 29514104 | ||
391 | Ubiquitination | EPHPVLEKLRSINNY CCCHHHHHHHCCCCC | - | ||
394 | Phosphorylation | PVLEKLRSINNYNPK HHHHHHHCCCCCCCC | 27600695 | ||
408 | Ubiquitination | KDFDWNLKHGRVFII CCCCCCCCCCEEEEE | - | ||
417 | Phosphorylation | GRVFIIKSYSEDDIH CEEEEEEECCHHHHH | 30635358 | ||
418 | Phosphorylation | RVFIIKSYSEDDIHR EEEEEEECCHHHHHH | 30635358 | ||
419 | Phosphorylation | VFIIKSYSEDDIHRS EEEEEECCHHHHHHH | 23684622 | ||
560 | Phosphorylation | IFDDFSHYEKRQEEE CCCCCHHHHHHHHHH | 25159016 | ||
569 | Phosphorylation | KRQEEEESVKKERQG HHHHHHHHHHHHHCC | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YTHD2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YTHD2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YTHD2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YTHD2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...