dbPTM

YQI9_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YQI9_CAEEL
UniProt AC	Q09507
Protein Name	Uncharacterized protein C45G9.9
Gene Name	C45G9.9
Organism	Caenorhabditis elegans.
Sequence Length	294
Subcellular Localization
Protein Description
Protein Sequence	MTTAITPDKKKLVSPKPTKTTSDKSKTKPRRSSKTSKKRKSKKGLFGCCAKKRKTKRSKKSAKRTKRSAPKKAPKKAPMKAPSKPAAKLVPQQAQASLQKPIQSGIVDADATVKTVVPRPPTPIPPTGVKPEPAPRSEPLYQPRSVSSTTPRTSATTGTTEQMVTAPATLPPPSAESKHLPQDPPGDASSPRVQRQYTAEKYSKEDQDDDDQKDLRKSVAYPSHKFFMTQYVKDECRVRRWVYEDSVPLMMESNMKHMLRMASNRIAACQSDKARRCDMMKDLNEMTEILDGNF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
189	Phosphorylation	QDPPGDASSPRVQRQ CCCCCCCCCHHHHHH	45.69	30078680
190	Phosphorylation	DPPGDASSPRVQRQY CCCCCCCCHHHHHHH	20.60	30078680

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YQI9_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YQI9_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YQI9_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YQI9_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YQI9_CAEEL

Related Literatures of Post-Translational Modification