YQ61_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YQ61_SCHPO
• UniProt AC: O94733
• Protein Name: Uncharacterized protein C191.01
• Gene Name: SPCC191.01, SPCC417.13
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 178
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MVTRRLSTNVHIDLQPIRQGILLPFHDRPAEMRDLAKCNDQFFRNVRDTISEPKFTQLMELWLEKSRAEVPDADFLMTTRNIMLSFPSNEEQGHQRSASHGSTSSATSTPKRLSISSMDPARIHLWRQFCNVVGYDMPTPGEQKEAPPSPAQEAIPESPVEEAIASDSDEEEEEEIKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MVTRRLSTNVHIDL -CCCEECCCCEEEEC	19.00	29996109
8	Phosphorylation	MVTRRLSTNVHIDLQ CCCEECCCCEEEECH	45.94	29996109
97	Phosphorylation	EEQGHQRSASHGSTS CCCCCCCCCCCCCCC	27.79	29996109
99	Phosphorylation	QGHQRSASHGSTSSA CCCCCCCCCCCCCCC	29.63	29996109
102	Phosphorylation	QRSASHGSTSSATST CCCCCCCCCCCCCCC	21.49	27738172
114	Phosphorylation	TSTPKRLSISSMDPA CCCCCEECCCCCCHH	25.18	28889911
135	Phosphorylation	QFCNVVGYDMPTPGE HHHHHHCCCCCCCCC	9.47	28889911
139	Phosphorylation	VVGYDMPTPGEQKEA HHCCCCCCCCCCCCC	36.97	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YQ61_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YQ61_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YQ61_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YQ61_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.