YQ13_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YQ13_SCHPO
• UniProt AC: O94520
• Protein Name: ER membrane protein complex subunit 4
• Gene Name: SPCC1281.03c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 193
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Sequence: MHINEETDWIDLVKPALAKKPKKIVDNSDKFPTPRGFQQKSLVSKNIHSGNSASSTSIFAKREEELQKDLLLKKAWELAYSPLKQIPMNAILAYMSGNSLQIFSIMTTLMLLVNPLKAITSTGSAFTPFKGTHPGTLWPAMGAYILFQLLLMGIGVYKLQRMGLLPTTTSDWLAWEVSKVFMDRSYGPSKTVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	LVSKNIHSGNSASST HHHCCCCCCCCCCCC	35.55	21712547
52	Phosphorylation	KNIHSGNSASSTSIF CCCCCCCCCCCCCHH	32.81	21712547
54	Phosphorylation	IHSGNSASSTSIFAK CCCCCCCCCCCHHHC	33.69	24763107
55	Phosphorylation	HSGNSASSTSIFAKR CCCCCCCCCCHHHCC	26.37	21712547
56	Phosphorylation	SGNSASSTSIFAKRE CCCCCCCCCHHHCCH	24.28	21712547
57	Phosphorylation	GNSASSTSIFAKREE CCCCCCCCHHHCCHH	20.04	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YQ13_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YQ13_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YQ13_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YQ13_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.