dbPTM

YPT6_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YPT6_CAEEL
UniProt AC	P41884
Protein Name	Uncharacterized protein F37A4.6
Gene Name	F37A4.6
Organism	Caenorhabditis elegans.
Sequence Length	389
Subcellular Localization
Protein Description
Protein Sequence	MLRPPMTKLVISNRESHRECEQVLQIGECAIVRSSSGEPWQLLNNGNSDSIDYALLQDILYEGYRLSTIYNIKSHTKSMKRLRRKLASIFSNSNFLLPLSKDGSSSSSQPHFYLSPSNSSLFDARKSSRSRGAVIKSPSTINIEKNRHSSNSGENQKMRLNLSMSTGNLCRAGVVRTPYPTSKQLHFDNDDGDEEDDTDDEGEADLVSIKTRSGRRNVLKSPPPPERIPSSMGASDAEEIDIKSHMKPLSVKIPANIFKTPTLDIPVDDDAEIDADVFPLPPPTPVNLKHGLFSIPSGRNSESARSRQTKRSPFGSVTSRTSSLDRRMSLSCLEDTSNYQKTQYLVFPLRTSSKKPYLLKFPEDMQEEDEKHNGSVWGSDTSLEEEIKV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
100	Phosphorylation	SNFLLPLSKDGSSSS CCEEEEECCCCCCCC	27.10	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YPT6_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YPT6_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YPT6_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YPT6_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YPT6_CAEEL

Related Literatures of Post-Translational Modification